KEGG   Streptomyces davaonensis: BN159_7343Help
Entry
BN159_7343        CDS       T02518                                 

Definition
(GenBank) Putative 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00780  Biotin metabolism
sdv01100  Metabolic pathways
Module
sdv_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BN159_7343
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sdv01007]
    BN159_7343
Enzymes [BR:sdv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     BN159_7343
Amino acid related enzymes [BR:sdv01007]
 Aminotransferase (transaminase)
  Class II
   BN159_7343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CCK31722
UniProt: K4RDY0
Position
8222306..8223433
Genome map
AA seq 375 aa AA seqDB search
MAFGWIDDQAELRRRAGLVRTLRPRPADSPLLDLASNDYLGLAHHPEVTEGAAEAARTWG
GGATGSRLVTGTTELHGELERELADFCGFEAALVFSSGYAANLAAVTALGPHGSLIVSDA
GNHASLIDGCRLARGTTQVVAHAEPDAVRKALHTHDGPAVAVSDTVFSVDGDAAPLAGLA
EACREYGAGLVVDDAHGLGVLGDGGRGAPYAAGLAGADDVVVTVTLSKSLGSQGGAVLGP
ARVIDHLVNAARTFIFDTGLAPAATGAALAALRLLRREPERAARARAVAGELHARLTAEG
HQAVRPDAAVVSVRAPSPEEAVRWAADCRGAGLAVGCFRPPSVPDGISRLRLTARADLTD
GQIERAVRVIGETRP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcggctggatcgacgaccaggcggagctgcgccgccgcgccggactcgtccgg
accctgcgcccccgccccgccgactcgccgctgctggacctcgcgagcaatgactacctg
ggcctggcccaccatccggaggtcaccgagggcgcggccgaggcggcgcggacctggggc
ggcggcgccaccggctcccggctcgtcaccggtacgacggagctgcacggcgagctggag
cgcgagctggcggacttctgcggtttcgaggcggcgctggtcttctcctccggctacgcg
gccaacctcgccgcggtcaccgcgctcgggccgcacggctcgctgatcgtgtcggacgcg
ggcaatcacgcctcgctcatcgacggctgccggctggcccgcggtacgacccaggtggtc
gcgcacgccgagccggacgccgtgcgcaaggcactgcacacccatgacggaccggcggtg
gcggtctccgacaccgtcttctcggtcgatggcgacgcggccccgctggccgggctcgcc
gaggcgtgccgggagtacggcgcgggactcgtggtcgacgacgcgcacgggctcggggtg
ctcggcgacggcggccggggtgccccctacgcggcggggcttgcgggcgccgacgacgtc
gtcgtcacggtgacgctgtccaagtcgctgggcagccagggcggtgccgtcctgggcccg
gcccgggtgatcgaccatctggtcaacgcggcccggacgttcatcttcgacaccggtctg
gcgcccgccgcgaccggtgccgccctggcggctctgcggctgctgcgccgggagccggag
cgggcggcacgggcgcgtgcggtggccggtgaactgcacgcccgcctgacggccgagggc
catcaggcggtgcgtccggacgccgcggtcgtctcggtgcgcgcgccgtccccggaggag
gccgtgcgctgggcggcggactgccggggggcgggcctcgccgtgggctgtttccgtcct
ccttccgtgcccgacggcatctcacggctgcggctgaccgcccgcgcggatctcacggac
gggcagatcgaacgcgctgtacgggtcatcggcgagacacgaccatga

DBGET integrated database retrieval system