KEGG   Streptomyces davaonensis: BN159_8007Help
Entry
BN159_8007        CDS       T02518                                 

Gene name
ribA9
Definition
(GenBank) Riboflavin biosynthesis protein RibBA
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00740  Riboflavin metabolism
sdv00790  Folate biosynthesis
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BN159_8007 (ribA9)
   00790 Folate biosynthesis
    BN159_8007 (ribA9)
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BN159_8007 (ribA9)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     BN159_8007 (ribA9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: CCK32385
UniProt: K4RFK3
Position
8963909..8964565
Genome map
AA seq 218 aa AA seqDB search
MFPLESVEEAIDTVRAGRPVVVADDNDRENEGDLIFAAQHATPELLAFMVRHTSGYVCAP
LPPQDCDRLELPPMHSINQDRRGTAYTVTVDAREGVTTGISAADRAHTIRLLADPATTAG
DLCRPGHVVPLRGVPGGVLRRTGHTEATLDLVRLAGCRPAGVLCELVNDDGTMKRLPDLR
RFADEFGLPLITVAQLVQYRRRIGDTYDVRDLAMGAAR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgttcccactcgaaagcgtcgaggaagccatcgacaccgtacgggccggaaggccggtc
gtggtggcggacgacaatgaccgggagaacgagggcgatctgatcttcgccgcccagcac
gccaccccggaactgctcgctttcatggtgcgccacacctcgggatatgtgtgtgcgcca
ttgcccccgcaggactgcgaccgcctcgaactgccgccgatgcactccatcaatcaggac
cggcgcggcacggcatataccgtgaccgtggatgcccgggaaggcgtcaccaccggaatt
tcggccgccgaccgtgcccacaccatccggctgctcgccgacccggccaccacggccgga
gacctgtgccggccgggccatgtggtcccgctgcgtggcgtccccggcggcgtgctgcgc
cggaccgggcacaccgaggcgacgctcgatctggtacgcctggccgggtgccgcccggcg
ggtgtgctgtgcgagctggtcaacgacgacgggaccatgaagcggctgcccgatctgcgc
cgcttcgccgacgagttcgggctgccgctcatcaccgtcgcccagttggtccagtaccgc
cgcaggatcggcgacacatacgacgtacgcgacctcgccatgggcgccgcgaggtga

DBGET integrated database retrieval system