KEGG   Shigella dysenteriae Sd197: SDY_0660Help
Entry
SDY_0660          CDS       T00306                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00020  Citrate cycle (TCA cycle)
sdy00190  Oxidative phosphorylation
sdy00650  Butanoate metabolism
sdy01100  Metabolic pathways
sdy01110  Biosynthesis of secondary metabolites
sdy01120  Microbial metabolism in diverse environments
sdy01130  Biosynthesis of antibiotics
sdy01200  Carbon metabolism
Module
sdy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sdy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sdy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SDY_0660 (sdhD)
   00650 Butanoate metabolism
    SDY_0660 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SDY_0660 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 3799724
NCBI-ProteinID: YP_402337
ShiBASE_China: SDY0660
UniProt: Q32IK9
Position
623085..623432
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggggtgtga

DBGET integrated database retrieval system