KEGG   Shigella dysenteriae Sd197: SDY_0702Help
Entry
SDY_0702          CDS       T00306                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00010  Glycolysis / Gluconeogenesis
sdy00260  Glycine, serine and threonine metabolism
sdy00680  Methane metabolism
sdy01100  Metabolic pathways
sdy01110  Biosynthesis of secondary metabolites
sdy01120  Microbial metabolism in diverse environments
sdy01130  Biosynthesis of antibiotics
sdy01200  Carbon metabolism
sdy01230  Biosynthesis of amino acids
Module
sdy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sdy_M00002  Glycolysis, core module involving three-carbon compounds
sdy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDY_0702 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SDY_0702 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SDY_0702 (gpmA)
Enzymes [BR:sdy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SDY_0702 (gpmA)
Membrane trafficking [BR:sdy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SDY_0702 (gpmA)
Exosome [BR:sdy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SDY_0702 (gpmA)
  Exosomal proteins of melanoma cells
   SDY_0702 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-GeneID: 3799480
NCBI-ProteinID: YP_402376
ShiBASE_China: SDY0702
UniProt: Q32IH0
Position
complement(659398..660150)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEGILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgtgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactaagcgagaaagagctgccgctgactgaaagcctggcgctgactattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtaatc
atcgctgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagggattcttgagctgaatatcccgaccggcgtgccgctagtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggcggttgctaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system