KEGG   Shigella dysenteriae Sd197: SDY_0830Help
Entry
SDY_0830          CDS       T00306                                 

Gene name
bioF
Definition
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00780  Biotin metabolism
sdy01100  Metabolic pathways
Module
sdy_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SDY_0830 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sdy01007]
    SDY_0830 (bioF)
Enzymes [BR:sdy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     SDY_0830 (bioF)
Amino acid related enzymes [BR:sdy01007]
 Aminotransferase (transaminase)
  Class II
   SDY_0830 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 3795821
NCBI-ProteinID: YP_402501
ShiBASE_China: SDY0830
UniProt: Q32I45
Position
complement(774213..775367)
Genome map
AA seq 384 aa AA seqDB search
MSWQEKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIR
AWKQGAEQFGVGSGGSGHVSGYSVAHQALEEELAEWLGYSRALLFISGFAANQAVIAAMM
AKEDRIVADRLSHASLLEAASLSPSQLRRFVHNDVTHLARLLASPCPGQQLVVTEGVFSM
DGDSAPLGEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKGFGV
SGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALIT
RFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARL
RLTLTAAHEMQDIDRLLEVLHGNG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggagaaaatcaacgcggcgctcgatgcgcggcgtgctgccgatgccctg
cgtcgccgttatccagtggcgcaaggagccggacgctggctggtggcggatgatcgccag
tatctgaacttttccagtaacgattatttaggtttaagccatcatccgcaaattatccgt
gcctggaagcagggggcggagcaatttggcgtcggtagcggtggttccggtcacgtcagc
ggttatagcgtggcgcatcaggcgctggaagaagaactggccgagtggctgggctattcg
cgggcactgctgtttatctctggttttgccgctaatcaggcggtcattgccgcgatgatg
gcaaaagaggaccgcattgtcgctgaccggctaagccatgcctcattgctggaggctgcc
agtttaagcccgtcgcagcttcgccgttttgttcataacgatgtcactcatctggcgcga
ctgcttgcttccccctgtccggggcagcaactggtggtgacagaaggcgtgttcagcatg
gacggcgatagtgcgccactgggggaaatccagcaggtaacgcaacagcacaatggctgg
ttgatggtcgatgatgcccacggcacgggcgttatcggggagcaggggcgcggcagctgc
tggctgcaaaaggtaaaaccagaattgctggtagtgacttttggcaaaggatttggcgtc
agcggggcagcggtgctttgctccagtacggtggcggattatctgctgcaattcgcccgc
catcttatctacagcaccagtatgccgcccgctcaggcgcaggcattacgtgcgtcactg
gcggtcattcgcagtgatgagggtgatgcacggcgcgaaaaactggcggcactcattacg
cgttttcgtgccggagtacaggatttgccgtttacgcttgctgattcatgcagcgccatc
cagccattgatcgtcggtgataacagccgtgcgttacaactggcagaaaaactgcgccag
caaggctgctgggtcacggcgattcgcccgccaaccgtacccgctggtactgcgcgactg
cgcttaacactaaccgccgcgcatgaaatgcaggatatcgaccgtctgctggaggtgctg
catggcaacggttaa

DBGET integrated database retrieval system