KEGG   Shigella dysenteriae Sd197: SDY_1329Help
Entry
SDY_1329          CDS       T00306                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00260  Glycine, serine and threonine metabolism
sdy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sdy01100  Metabolic pathways
sdy01110  Biosynthesis of secondary metabolites
sdy01130  Biosynthesis of antibiotics
sdy01230  Biosynthesis of amino acids
Module
sdy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SDY_1329 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SDY_1329 (trpB)
Enzymes [BR:sdy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SDY_1329 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 3798761
NCBI-ProteinID: YP_402967
ShiBASE_China: SDY1329
UniProt: Q32GS9
Position
complement(1228479..1229672)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETDVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacggctggcacgaacaccacgctgtatctgaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggtgccaaagacgttgaa
cgccagtcacctaacgtttttcgtatgcgtttaatgggtgcggaagtgatcccggtacat
agcggttccgcgacgctgaaagatgcctgtaacgaggcgctacgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggcaccgcagccggcccgcatccttatccgaccatt
gtgcgtgagtttcagcggatgattggcgaagaaaccaaagcacagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggcggttcgaatgccatcggtatg
tttgcagatttcatcaacgaaaccgacgtcggcctgattggtgtggagccgggtggtcac
ggtatcgaaactggcgagcacggcgcaccgctaaaacatggtcgcgtgggcatttatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcagattgaagaatcttactccatc
tccgccggattggatttcccgtctgtcggcccacaacacgcgtatcttaacagcactgga
cgcgctgattacgtgtctattaccgatgatgaagcccttgaagccttcaagacgctgtgc
ctacacgaagggatcatcccggcgctggaatcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaacccggaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system