KEGG   Shigella dysenteriae Sd197: SDY_2203Help
Entry
SDY_2203          CDS       T00306                                 

Gene name
galF
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00040  Pentose and glucuronate interconversions
sdy00052  Galactose metabolism
sdy00500  Starch and sucrose metabolism
sdy00520  Amino sugar and nucleotide sugar metabolism
sdy01100  Metabolic pathways
sdy01130  Biosynthesis of antibiotics
Module
sdy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sdy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SDY_2203 (galF)
   00052 Galactose metabolism
    SDY_2203 (galF)
   00500 Starch and sucrose metabolism
    SDY_2203 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    SDY_2203 (galF)
Enzymes [BR:sdy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SDY_2203 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 3797481
NCBI-ProteinID: YP_403779
ShiBASE_China: SDY2203
UniProt: Q32EG7
Position
2005517..2006410
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQLGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcatatgttgcctgcc
actaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgaattagaatctcttcttgagcagcgc
gtgaagcgtcaactactggcggaagtacagtccatttgcccgccgggcgtgaccattatg
aacgtgcgtcagggcgaacctttaggtttgggccactccattttatgtgcacgacccgcc
attggtgacaatccatttgtcgtggtgctgccagacgttgtgatcgacgacgccagcgcc
gacccgctgcgctacaaccttgctgccatgattgcacgtttcaacgaaacgggtcgtagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactcggtcatccagaccaaa
gaaccactggaccgtgaaggtaaagtcagccgcattgttgaattcatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgttggtcgctatgtgctttctgccgat
atttggccggaactagaacgcactcagctaggtgcatggggacgtattcagctgactgat
gccattgccgaactggcgaaaaaacagtccgttgatgccatgctgatgactggagacagc
tacgactgcggaaaaaaaatgggctatatgcaggcgtttgtgaagtatgggctgcgcaac
ctcaaagaaggggcgaagttccgtaaagggattgagaagctgttaagcgaataa

DBGET integrated database retrieval system