KEGG   Shigella dysenteriae Sd197: SDY_3189Help
Entry
SDY_3189          CDS       T00306                                 

Gene name
dsbC
Definition
(RefSeq) thiol:disulfide interchange protein DsbC
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sdy  Shigella dysenteriae Sd197
Brite
Enzymes [BR:sdy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SDY_3189 (dsbC)
Chaperones and folding catalysts [BR:sdy03110]
 Protein folding catalysts
  Protein disulfide isomerase
   SDY_3189 (dsbC)
Secretion system [BR:sdy02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SDY_3189 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N Thioredoxin_4 DSBA TraF HxlR
Motif
Other DBs
NCBI-GeneID: 3796014
NCBI-ProteinID: YP_404690
ShiBASE_China: SDY3189
UniProt: Q32BV6
Position
2955221..2955931
Genome map
AA seq 236 aa AA seqDB search
MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYIT
DDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGY
CHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAP
ANCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKDMKEFLDEHQKMTSGK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggttttatgttgtttactttgttagcggcgttttcaggctttgctcaggct
gatgacgcggcaattcaacaaacgttagccaaaatgggcatcaaaagcagcgatattcag
cccgcgcccgtagctggcatgaagacagttctgactaacagcggcgtgttgtacatcacc
gatgatggtaaacatatcattcaggggccaatgtatgacgttagtggcacggctccggtc
aatgtcaccaataagatgctgttaaagcagttgaatgcgcttgaaaaagagatgatcgtt
tataaagcgccgcaggaaaaacacgtcatcaccgtgtttactgatattacctgtggttac
tgccacaaactgcatgagcaaatggcagactacaacgcgctggggatcaccgtgcgttat
cttgctttcccgcgccaggggctggatagcgatgctgagaaagaaatgaaagctatctgg
tgtgcgaaagacaaaaacaaagcgtttgatgatgtgatggcaggtaaaagcgtcgcacca
gccaattgcgacgtggatattgccgaccattacgcacttggcgtccagcttggcgttagc
ggtactccggcagttgtgctgagcaatggcacacttgttccgggttaccagccgccgaaa
gacatgaaagaattcctcgacgaacaccaaaaaatgaccagcggtaaataa

DBGET integrated database retrieval system