KEGG   Shigella dysenteriae Sd197: SDY_3858Help
Entry
SDY_3858          CDS       T00306                                 

Gene name
yihX
Definition
(RefSeq) phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sdy  Shigella dysenteriae Sd197
Pathway
sdy00010  Glycolysis / Gluconeogenesis
sdy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SDY_3858 (yihX)
Enzymes [BR:sdy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     SDY_3858 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P
Motif
Other DBs
NCBI-GeneID: 3797238
NCBI-ProteinID: YP_405291
ShiBASE_China: SDY3858
Position
complement(3590205..3590804)
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLATLKKSFHMGEAFHQHERGEISDEAFAEA
LCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEE
YPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGIT
SILVKDKTTIPDYFAKVLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgatatcgactttaaccgtgtgctg
ggagcctggagcgatttaacgcgtattccgctggctacgcttaagaagagttttcatatg
ggggaggcgtttcatcagcatgagcgtggggaaattagcgacgaagcgttcgcagaggcg
ctgtgtcatgagatggctctaccgctaagctacgagcagttctctcacggctggcaggct
gtgtttgttgcgctgcgcccggaagtgatcgccatcatgcataaactgcgtgagcagggg
catcgcgtggtggtgctttccaataccaaccgcctgcataccaccttctggccggaagaa
tacccggaaattcgtgatgctgctgaccatatctatctgtcgcaagatctggggatgcgc
aaacctgaagctcgaatttaccagcatgttttgcaggcggaaggtttttcacccagcgat
acggtctttttcgacgataacgccgataatatagaaggagctaatcagctgggcattacc
agtattctggtgaaagataaaaccaccatcccggactatttcgcgaaggtgttatgctaa

DBGET integrated database retrieval system