KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_00848Help
Entry
Asd1617_00848     CDS       T02933                                 

Definition
(GenBank) Methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz00630  Glyoxylate and dicarboxylate metabolism
sdz00660  C5-Branched dibasic acid metabolism
sdz01100  Metabolic pathways
sdz01120  Microbial metabolism in diverse environments
sdz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Asd1617_00848
   00660 C5-Branched dibasic acid metabolism
    Asd1617_00848
Enzymes [BR:sdz01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     Asd1617_00848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AHA63675
UniProt: A0A0A6ZP69
Position
complement(625866..627023)
Genome map
AA seq 385 aa AA seqDB search
MTAFFYTGEPVTQGFNAVRQAGECVSVQLILENGAVAVGDCTAVQYSEAGGRDPLFLAEH
FIPFLNDHIKPLLVGRDVDAFLPNARFFDKLRIDGNLLHTAVRYGLSQALLDATALATGR
LKTEVVCDEWQLPRVAESIPLFGQSGDDRYIAVDKMILKGIDVLPHALINNVEEKLGFKG
EKLLEYVRWLSDRILSKRTSTRYHPTLHIDVYGTIGLIFDMDPLRCAQYIASLEKEAQGL
PLYIEGPVDAGNKPDQIRLLTAITKELTRLGSGVKIVADEWCNTYQDIVDFTDAASCHMV
QIKTPALGSIHNIVDAVLYCNSHSMEAYQGGTCNETDVSARTCVHVALAARPMRMLVKLG
MGFDEGLDIVFNEMNRTIALLQAKD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgacggcttttttttataccggggagccggtaacacaggggtttaacgccgttcgtcag
gccggggagtgcgtatcggtacagttgattctggaaaacggcgcggtcgccgtaggtgac
tgtactgccgtacagtattccgaggcaggcggtcgcgatccactgttcctcgcagagcac
tttattccgttcctcaacgaccatatcaagccattactggtaggccgcgatgtggatgct
ttcctgccgaatgcccgtttcttcgacaaattgcgtattgacggcaacttgctgcatacc
gccgtgcgctacggattatcacaggcgctgcttgatgctaccgcgctggcaaccggccgt
ctgaaaactgaagtggtctgtgatgaatggcagttgccacgcgtggcggaatccattcca
ttatttggtcagagcggcgacgatcgatatatcgccgtcgataagatgatccttaaaggc
atcgacgtgctgccccatgcgctgattaataacgtcgaagagaagctgggctttaaaggt
gaaaaactgctcgaatatgtccgctggttgtcggatcgcattctaagcaagcgcaccagc
acacgctaccaccctaccctgcacatcgatgtatacggcactatcggtctgatcttcgat
atggatccgcttcgctgtgcacaatacatcgccagcctggaaaaagaagcgcaaggcctg
ccgctctacattgaagggccggtcgatgccggtaacaagcccgaccaaattcgcctgctg
accgcgattaccaaagagctgacgcgcctcggttccggcgtgaaaattgtggccgatgaa
tggtgtaacacctaccaggatattgttgatttcactgatgctgccagttgtcacatggtg
caaatcaaaactccggctctgggcagtattcacaacatcgtcgatgcggttctttactgc
aacagccacagcatggaagcgtaccagggcggcacctgcaatgaaactgatgtcagtgcc
cgcacctgtgtccacgtcgcccttgccgctcgccctatgcgtatgctggtaaaactaggg
atgggctttgacgaaggcctcgatattgtcttcaacgaaatgaatcgtactatcgcgctg
ttgcaggctaaggattaa

DBGET integrated database retrieval system