KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_01238Help
Entry
Asd1617_01238     CDS       T02933                                 

Definition
(GenBank) Glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz00010  Glycolysis / Gluconeogenesis
sdz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asd1617_01238
Enzymes [BR:sdz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     Asd1617_01238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AHA64065
UniProt: A0A0A6ZQE0
Position
914832..916097
Genome map
AA seq 421 aa AA seqDB search
MITKEVPGMNKTLITATVAGIVLLASNAQAQTVPEGYQLQQVLMMSRHNLRAPLANNGSV
LEQSTPNKWPEWDVPGGQLTTKGGVLEVYIGHYMREWLAEQGMVKSGECPPPDTVYAYAN
SLQRTVATAQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEQAVAPMEKEL
SKLQLTDSYQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLV
DAFTLQYYEGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYID
KALVTDRTSAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSKA
NRDLMKIEYVYQSAEQLRNADALTPQAPAQRVTLELSGCPIDADGFCPMDKFDSVLNEAV
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
ttgataacaaaagaggtgccaggaatgaacaaaacgctaatcaccgcaactgtggcaggg
atagttttactcgcttcaaatgctcaggcacaaaccgtaccggaaggctatcagctacag
caagtgctcatgatgagccgccataacttacgtgcgccgctggcgaacaatggcagtgtg
ctggagcagtcgacgccgaataaatggcccgaatgggacgtccccggtgggcaactcacc
accaaaggtggcgtgctcgaagtgtatataggccattacatgcgtgaatggctggcagag
caggggatggtgaaatcgggggaatgtccgccgccggacaccgtttatgcctatgccaat
agtctgcaacgtaccgttgcgaccgcacagttctttattaccggcgcattcccggggtgt
gatattcctgtgcatcaccaggaaaaaatgggcaccatggacccaacctttaacccggtg
atcaccgatgattccgccgcattcagtgaacaggcggtggcgccaatggagaaagagctc
agcaaactccagcttaccgacagctaccagctactggaaaaaatcgttaactataaagat
tcccctgcctgtaaagagaaacaacagtgttcgctggtggatggcaaaaatacctttagc
gcgaagtatcaacaagaaccaggtgtttccgggccgctgaaagtcggcaactcgctggta
gatgcgtttactttgcaatactacgaaggttttccgatggatcaggtggcctggggagaa
atcaaatctgaccagcaatggaaggtgttgtcgaagctgaaaaacggttaccaggacagc
ctgtttacctcaccggaagtggcgcgcaatgttgcgaaaccgctggtcagttatatcgac
aaagccctggtcaccgatcgcaccagtgcaccaaaaatcacggtgttagttgggcatgac
tccaacattgcctctctgttaacggcgctggatttcaaaccgtatcagttgcatgaccag
aacgaacgcactccgattggcggcaaaatcgttttccagcgttggcatgacagcaaagcc
aatcgcgatttgatgaaaattgaatatgtgtaccagagtgcggaacagttacgtaatgcc
gatgcgttaaccccgcaggcacctgcgcagcgcgtgacgctggaattaagcggttgcccg
atagacgctgatggtttctgcccgatggataagtttgatagcgtgttgaatgaagcggtg
aaataa

DBGET integrated database retrieval system