KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_02358
Entry
Asd1617_02358     CDS       T02933                                 

Definition
(GenBank) Aldehyde dehydrogenase A
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AHA65185
UniProt: A0A0A6ZTH3
Position
complement(1569147..1569458)
AA seq 103 aa
MSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIKGLKFSETY
INRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtcgattatgcatgaggaaacctttggcccggtgctgccagttgtcgcatttgacacg
ctggaagatgctatctcaatggctaatgacagtgattacggcctgacctcatcaatctat
acccaaaatctgaacgtcgcgatgaaagccattaaagggctgaagtttagtgaaacttac
atcaaccgtgaaaacttcgaagctatgcaaggcttccacgccggatggcgtaaatccggt
attggcggcgcagatggtaaacatggcctgcatgaatatctgcagacccaggtggtttat
ttacagtcttaa

DBGET integrated database retrieval system