KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_02358Help
Entry
Asd1617_02358     CDS       T02933                                 

Definition
(GenBank) Aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz00620  Pyruvate metabolism
sdz00630  Glyoxylate and dicarboxylate metabolism
sdz01100  Metabolic pathways
sdz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Asd1617_02358
   00630 Glyoxylate and dicarboxylate metabolism
    Asd1617_02358
Enzymes [BR:sdz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     Asd1617_02358
    1.2.1.22  lactaldehyde dehydrogenase
     Asd1617_02358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHA65185
UniProt: A0A0A6ZTH3
Position
complement(1569147..1569458)
Genome map
AA seq 103 aa AA seqDB search
MSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIKGLKFSETY
INRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattatgcatgaggaaacctttggcccggtgctgccagttgtcgcatttgacacg
ctggaagatgctatctcaatggctaatgacagtgattacggcctgacctcatcaatctat
acccaaaatctgaacgtcgcgatgaaagccattaaagggctgaagtttagtgaaacttac
atcaaccgtgaaaacttcgaagctatgcaaggcttccacgccggatggcgtaaatccggt
attggcggcgcagatggtaaacatggcctgcatgaatatctgcagacccaggtggtttat
ttacagtcttaa

DBGET integrated database retrieval system