KEGG   Shigella dysenteriae 1617 (serotype 1): Asd1617_03306Help
Entry
Asd1617_03306     CDS       T02933                                 

Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose N-formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
sdz  Shigella dysenteriae 1617 (serotype 1)
Pathway
sdz00520  Amino sugar and nucleotide sugar metabolism
sdz01100  Metabolic pathways
sdz01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:sdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Asd1617_03306
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Asd1617_03306
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sdz01005]
    Asd1617_03306
Enzymes [BR:sdz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     Asd1617_03306
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     Asd1617_03306
Lipopolysaccharide biosynthesis proteins [BR:sdz01005]
 Unusual sugar
  Asd1617_03306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: AHA66133
UniProt: E2X679
Position
2208023..2208268
Genome map
AA seq 81 aa AA seqDB search
MLLASFEKHPLRHHFPPFAGFRVVESSSYYGKGYQDVEHRKPSIRNAHRCLDWEPKIDMQ
ETIDETLDFFLRTVDLTDKPS
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggcgagcttcgaaaaacatccgctgcgccatcatttcccaccgtttgcgggc
tttcgcgttgtcgaaagtagcagctactacggcaaaggatatcaggacgtagagcatcgt
aaaccgagcatccgcaacgcccaccgctgcctggactgggagccgaaaattgatatgcag
gaaaccatcgacgaaacgctggatttcttcctgcgcaccgttgatcttacggataaacca
tcatga

DBGET integrated database retrieval system