KEGG   Shigella dysenteriae 1617: Asd1617_03442Help
Entry
Asd1617_03442     CDS       T02933                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sdz  Shigella dysenteriae 1617
Pathway
sdz00052  Galactose metabolism
sdz00500  Starch and sucrose metabolism
sdz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Asd1617_03442
   00500 Starch and sucrose metabolism
    Asd1617_03442
Enzymes [BR:sdz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Asd1617_03442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AHA66269
UniProt: A0A0A6ZWP6
Position
2308294..2309736
Genome map
AA seq 480 aa AA seqDB search
MIKMTQSRLHAAQNALAKLHEHRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHH
PMSEHWGPMHWGHATSDDMIHWQHEPIALAPGDDNDKDGCFSGSAVDDNGVLSLIYTGHV
WLDGAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGA
KDPGNTGQILLYRGSSLREWTFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNA
EGYSYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFLAKDGRRIVIGWMDM
WESPMPSKREGWAGCMTLARELSESNGKLLQHPVHEAESLRQQHQSISPRTISNKYVLQE
NAQAVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLVLWRYYPHENLDGYRSIPLP
QRDTLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEERELSLYASHGVAVVQHGALWQLG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatgacgcaatctcgattgcatgcggcgcaaaacgcactagcaaaacttcat
gagcaccggggtaacactttctatccccattttcacctcgcgcctcctgccgggtggatg
aacgatccaaacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcac
ccaatgagtgaacactgggggccaatgcactggggacatgccaccagcgacgatatgatc
cactggcagcatgagcctattgcgctagcgccaggagacgataatgacaaagatgggtgt
ttttcaggtagtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtc
tggctcgatggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagt
cgggatggtattcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatg
cacttccgcgatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcg
aaagacccaggcaacacggggcagatcctgctttatcgcggcagttcattacgtgaatgg
actttcgatcgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccg
gactttttcagccttggcgatcagcattatctgatgttttccccgcagggaatgaatgcc
gagggatacagttatcgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgcca
gggcgactttttgcacaatccgggcattttactgaacttgataacgggcatgacttttat
gcaccacaaagctttttagcgaaggatggtcggcgtattgttatcggctggatggatatg
tgggaatcgccaatgccctcaaaacgtgaaggctgggcaggctgcatgacgctggcgcgt
gagctatcagagagcaatggcaaactcctacaacacccggtacacgaagctgagtcgtta
cgccagcagcatcaatctatctctccccgcacaatcagcaataaatatgttttgcaggaa
aacgcgcaagcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacat
tacggattacagctcggcactggaatgcggctgtatattgataaccaatctgagcgactt
gttttgtggcggtattacccacacgagaatttagacggctaccgtagtattcccctcccg
cagcgtgacacgctcgccctaaggatatttatcgatacatcatccgtggaagtatttatt
aacgacggggaagcggtgatgagtagtcgaatctatccgcagccagaagaacgggaactg
tcgctttatgcctcccacggagtggctgtggtgcaacatggagcactctggcaactgggt
taa

DBGET integrated database retrieval system