KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1095Help
Entry
SeAg_B1095        CDS       T00751                                 

Definition
(GenBank) Pmt1
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF_C
Motif
Other DBs
NCBI-ProteinID: ACH49737
UniProt: B5F217
Position
complement(1091793..1092053)
Genome map
AA seq 86 aa AA seqDB search
MREGNESKRALIGVSGGAPRSISFSGPWAQFRLFGAGQLTGVQEGTFSVRFNVDGGAMVY
RVHTDTEDNPFTGGLFSQFRLPDTLY
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaggcaatgaaagtaagcgggcgctgataggcgtcagtggcggcgcgccgcgc
agcatcagtttcagcgggccgtgggcacagttcaggctgttcggcgccgggcaacttacc
ggcgttcaggaggggacattcagcgtgcgctttaacgtggacggcggagcgatggtgtac
cgggtacataccgatacggaagataaccccttcaccggcgggctgttcagtcagttccgg
ctgccggataccctgtactga

DBGET integrated database retrieval system