KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1097Help
Entry
SeAg_B1097        CDS       T00751                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K06887  uncharacterized protein
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Brite
KEGG Orthology (KO) [BR:sea00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SeAg_B1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ACH52551
UniProt: B5F219
Position
complement(1093488..1093967)
Genome map
AA seq 159 aa AA seqDB search
MANLSYLTLNGEKQGLISAGCSSMASIGNKAQIAHIDQILVLALEHGVTRNQNVNHLALT
IRKPVDKATPLLNKAITENEILTCDIEFYRTNRFGINEMYYKIQLLKARIASIHLIVPHT
VSSSDGQPEENISFIYETFTHEHCIAGTSAFSTWNTRLF
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatttaagttatttgacacttaatggagaaaaacagggactgatttcagcgggg
tgttcatcaatggcatccattggcaataaggcacaaatcgctcacatcgatcaaatttta
gtcctggcccttgaacatggcgtcacgcggaatcaaaacgtaaaccaccttgctctgact
attcgaaaaccagtggataaagctactcctttgttaaataaagcaattacagaaaatgaa
attctgacctgcgatattgagttttaccggactaatcgcttcggtataaatgagatgtat
tacaaaatacagttgcttaaagcccgtattgcaagcattcatttaatagttccacatacg
gtaagcagcagtgacgggcaaccggaagaaaatatatcatttatttatgaaacatttacg
catgaacattgtattgcggggaccagtgcattcagcacctggaatacgcgtcttttttaa

DBGET integrated database retrieval system