KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1099Help
Entry
SeAg_B1099        CDS       T00751                                 

Gene name
icmF
Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sea00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeAg_B1099 (icmF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sea02044]
    SeAg_B1099 (icmF)
Secretion system [BR:sea02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeAg_B1099 (icmF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C AAA_33 AAA_16 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACH49194
UniProt: B5F221
Position
complement(1095358..1098819)
Genome map
AA seq 1153 aa AA seqDB search
MPRFKVSAAWLLALAWILLLVWIWWKGPSWTLYEQRWLAPLANRWLATAAWGLIALAWLT
VRVMKRLQLLEKQQRQQRDEAQDPLSVELNTQQRYLDHWLLRLQRHLDSRRYLWQLPWYM
VIGPAGSGKTTLLREGYPSDIIYAPEALRGVEQRRYVIPHVGKQAVIFDADGLLFEQQDA
DILHRRLWTHMLDWLAQKRARQPLNGLILTLDLPDLLTADKPRREHLLQILRGRLQDIRQ
HLHCQLPVYVVLTRLDLLHGFAALFQSLDRNDRDAILGVTFTRHAHENDDWRTELNAFWQ
AWGERLNNALPERMLAPGSRSSLFSFVRQIQGGREPLIALLNGLLDGENMDVMLRGVYLT
SSLQRGQIDDIFMQSAARQFRLGSSPLTAWPLVDTLPYFTRNLFPQTLLAEPNLASESRV
WLMQSRRRLSVFSATGGIAALLLIIGWHHYYNNNWRSGITVLEQAKAFMSVPPPQGMDEY
GNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRVGPYVEQTYLQLLEQRYLPALFN
GLVKEMNAAPAESEEKLAVLRVIRMLEDKSGRSDEVVKQYMAKRWSDKFHGQRDIQAQLM
SHLDYALKHTDWHAERQAGDGDAISRWTPYDSPVVAAQKELSKLPVYQRVYQSLKTRAMG
VLPADLNLRDQVGATFDQVFTSGDDNKLIVPQFLTRYGLQSYFVKQRDALIELTAMDSWV
LNLTRSVKYSDADRAEIQRQLTEQYLSDYTATWRAGMDNLNVRNYESIAQLTGALEQIIS
GDQPLQRALTALRDNTQPAVLSEKLDDKALQEAMAEPDYQLLTRLGHEFAPENSTLAIQK
DKENTLQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLP
APLNRWVGKLADQAWHVVMVEAVHYMEIDWRDNVVKPFNEQLANNYPFNPRSQSDASLDA
FERFFKPNGVLDTFYQQNLRLFMENDLSLEDGDNNVIIREDVREQLDTAQEIREAFFSRQ
NGLGAQFAVETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIG
VSGGAPRSISFSGPWAQFRLFGAGQLTGVQEGTFSVRFNVDGGAMVYRVHTDTEDNPFTG
GLFSQFRLPDTLY
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atgccccggtttaaggtttctgccgcctggctgctggcgctggcgtggattttgctgctg
gtatggatctggtggaaaggtccgtcatggacgctctacgagcagcgctggctggccccg
ctggcgaaccgctggctggccaccgccgcctgggggttgattgcgctggcgtggctgacc
gtccgggtcatgaagcgcctgcaactgctggaaaaacagcagcgccagcaacgggacgag
gcgcaggatccgctcagcgtggaactgaacacccagcaacgctatctcgatcactggtta
ctgcgtctgcaacgccatctcgacagccgccgctatctgtggcagctaccgtggtatatg
gtcattggcccggcaggaagcggtaaaaccacgctgttgcgcgaagggtatccgtccgac
atcatttatgccccggaggcgctgcggggcgtggagcagcgccggtatgttatcccgcat
gtgggaaaacaggcggtgatttttgacgccgacggtctcctctttgagcaacaggatgcg
gatatactgcatcgccgcctgtggacccatatgctggactggctggcgcaaaaacgcgcc
cggcagccgctgaacggtctgatactgacgctggatctgcccgatctgctgaccgccgac
aagccacgccgtgagcacctgttgcagatcctgcgcggacgtttgcaggatatacgccag
catcttcactgccagctccccgtctatgtggtgctgacccggctggatctactgcacggt
ttcgccgccctgtttcagtcactggaccgcaacgatcgcgacgccattcttggcgtcacc
tttacccgtcatgcccatgaaaatgacgactggcgtacagaactgaatgccttctggcag
gcatggggcgaacggttgaataacgccctgccggagcggatgttagcccccggctcccgc
agttccctgttcagctttgtccgccagatccaggggggccgcgagccgctgatcgccctg
ctgaacgggctgctggacggggaaaatatggatgtgatgctgcgcggcgtgtacctcacc
tcctccctgcaacgcggccagatagacgatatttttatgcagtccgccgcccgtcagttc
cggctgggcagcagcccgctgaccgcctggccgctggtggacacgttaccgtatttcacc
cgtaatctgtttccgcagaccttactggctgagcctaacctcgccagtgaaagccgcgtc
tggctgatgcagtcccgccgccggttgtccgtgttttccgccaccggcggcatcgccgcc
ctgctgctgattatcggctggcatcactattacaataacaactggcgttccggcatcacc
gtactggagcaggccaaagcctttatgtccgtgccgccaccgcagggtatggacgaatac
ggcaacctgcaactgccgttacttaacccggtgcgtgacgccacgctggcctacggcgac
tggggcgatcgcagccgcctggccgatatgggattatatcagggcaggcgtgtcggccca
tatgtggagcagacctacctgcaactgctggagcagcgttacctgcccgccctgtttaac
ggcctggtcaaagagatgaatgccgcgcctgcggagagcgaggagaagcttgcggtattg
cgcgttatcagaatgctggaagataaaagcggacgcagcgacgaggtggtgaagcagtat
atggcgaaacgctggagtgataaatttcacggccagcgcgatattcaggcacagctgatg
tctcatctggactacgcgctgaaacacaccgactggcacgcggagcgtcaggcaggcgac
ggcgacgccatcagccgctggacgccgtatgacagtccggtcgtggcggcgcagaaagag
ctcagcaaactgcccgtctaccagcgcgtttaccagagtctgaaaacgcgggcgatgggc
gtgctgcccgctgacctgaacctgcgcgaccaggtgggcgccacgtttgatcaggtcttt
acctccggggatgataataagctcattgttccgcagttcctcacccgttacggtctgcaa
agttattttgtcaaacagcgcgacgcgctgatcgaactgacggcgatggattcctgggtg
ctgaacctgacccgcagcgtgaaatacagcgacgccgaccgggcagaaatccagcgccag
ctcactgaacagtatctcagcgactacaccgccacctggcgagccggaatggacaacctt
aacgtgcgcaattacgaatccattgcgcaactgaccggggcgctggagcagatcatcagc
ggcgatcagccgctccagcgggcgctgacggcactgcgcgacaacacgcagcctgccgtt
ctctctgaaaaactggatgacaaggcgcttcaggaggcgatggcggagccggattaccag
ttgctgacccgcctggggcatgaatttgccccggaaaacagcacgctggcgatacagaaa
gacaaagaaaacaccctccaggcggtctatcagcaactgacggagctgcaccgttacctg
ctggctattcagaacgcgccggtgccgggaaaatcagcgctgaaagcggtgcagctacgg
ctggatcagaacagcagcgatcctattttcgccacccgccagatggcgaaaaccctgcct
gccccgctcaaccgctgggtgggcaagctggcggatcaggcctggcacgtggtgatggtg
gaagcggtccattacatggagattgactggcgtgacaacgtggtgaaaccgtttaacgaa
cagcttgccaacaactatccgtttaacccgcgctcacagtcagatgcgtcgctggatgcg
tttgaacgcttctttaaaccgaatggcgtactggataccttttatcagcagaacctgcgg
ctgtttatggaaaacgatctgagtctggaggacggggataacaacgtgattattcgtgag
gatgtccgggagcaactggataccgcacaggaaatccgcgaggcgtttttcagcagacag
aacggcctgggcgcgcagtttgccgtggaaaccgtgtcgctttccggcaacaaacggcgc
agcgtgctgaacctggacgggcagttagtggactacagccagggccgcaattacaccgcc
catctggtctggccgaacaacatgcgtgaaggcaatgaaagtaagctgacgctgataggc
gtcagtggcggcgcgccgcgcagcatcagtttcagcggaccgtgggcgcagttcaggctg
ttcggcgccgggcaacttaccggcgttcaggaggggacattcagcgtgcgctttaacgtg
gacggcggagcgatggtgtaccgggtacataccgatacggaagataaccccttcaccggc
gggctgttcagtcagttccggctgccggataccctgtactga

DBGET integrated database retrieval system