KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1111
Entry
SeAg_B1111        CDS       T00751                                 

Definition
(GenBank) type VI secretion protein, family
  KO
K11901  type VI secretion system protein ImpB
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Brite
KEGG Orthology (KO) [BR:sea00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sea02044]
    SeAg_B1111
Secretion system [BR:sea02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeAg_B1111
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACH52449
UniProt: B5F2N3
Position
complement(1112818..1113321)
AA seq 167 aa
MSKDYNGSVAPKERINISYIPKTDGEPSEVELPLNMLIVGDTGNSQETAPLDERQMVSID
KHSFNSVMAEASISLNFAVPASLKDDAKDGDEMNISLEIKSLNDFSPDSVAKQVPELNKL
LELREALTALKGPLGNLPAFRAQLQALLENEESREQLLREISQAENQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagcaaagattataacggcagcgtggcacccaaagaacgcattaatatttcttatatt
ccaaaaacggacggtgagccttctgaggtggaattaccccttaatatgttgatagtgggg
gataccggaaactcacaggaaacagcgccacttgatgaacgccagatggtttctatcgac
aaacattcattcaattcagtgatggcagaagcgtccattagcctgaattttgcagttccg
gcatcattgaaggacgacgcaaaagatggcgatgagatgaatatctcgctggaaatcaaa
tccctgaacgatttttctccggacagtgtggcaaaacaggtgccggagttgaacaaattg
ctggaactacgcgaagcgctgacagcattaaaagggccgctgggtaatctgcctgcattt
cgcgcccagcttcaggcattgctggaaaatgaagaatcccgcgaacagttactgcgggag
atcagccaggcagaaaaccagtaa

DBGET integrated database retrieval system