KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1113Help
Entry
SeAg_B1113        CDS       T00751                                 

Definition
(GenBank) hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sea00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeAg_B1113
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sea02044]
    SeAg_B1113
Secretion system [BR:sea02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeAg_B1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP DCAF15_WD40 SBBP
Motif
Other DBs
NCBI-ProteinID: ACH48621
UniProt: B5F2N5
Position
1113950..1114468
Genome map
AA seq 172 aa AA seqDB search
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPS
GQRSHKPFIFTVALNKAVPLLYNALASGEMLPKTELHWWRTSVEGKQEHYFTTRLTDSTI
VDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaccgtgttacatctcaattacggggcaaacccagggcaatatcaccgctggt
gcattcaccgcagattctgtcggcaatatctacgtgcagggtcacgaggatgaaatgctg
gtacaggaattcctgcataacgtgaccgtacccaccgatccacagtccgggcagccgagc
ggccagcgttcgcacaagccgttcatttttaccgtggcgctgaacaaagccgtaccgctg
ctgtacaacgcgctggcgtccggtgaaatgctgccgaaaaccgaactgcactggtggcgt
acttccgttgaaggcaagcaggagcattacttcaccacccgcctgacggactcaacgatt
gtggatatgaaactgcatatgccgcactgtcaggacccggcaaagcgcgaattcacgcag
ttgctcgaagtctcgctggcctaccgcaaaatcgagtgggaacacgtcaaatccggcacc
tctggcgcggatgactggcgcgcgccgctggaagcgtaa

DBGET integrated database retrieval system