KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1114Help
Entry
SeAg_B1114        CDS       T00751                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sea00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeAg_B1114
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sea02044]
    SeAg_B1114
Secretion system [BR:sea02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeAg_B1114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C T6SS_Vgr
Motif
Other DBs
NCBI-ProteinID: ACH49270
UniProt: B5F2N6
Position
1114691..1116832
Genome map
AA seq 713 aa AA seqDB search
MSTGLRFTLEVDGLPPDALVVESFHLSQSLSTLFSLDISLVSQQLLNIDFSQVLEQPAHL
KIWQGTEIQRRVNGIVTWFEQGENDGHQMLYSMKVRPPVWRAALRQNSRIFQNEDIKSIL
GTILQENGVTDWSPLFSEPHPAREFCVQYSETDYDFLARMAAEEGIFFYEEHAQTSDDQS
LVLCDTVRFLPEAFEIPWNPNTRTEVSTPCVSQFRHSAQIRPSSVIGKDYTFKRPGWAGR
FEHQGEHQDYQRTQYEVFDYPGRFKDGHGQNFTRWQMEGWRNNAEVAQGKSRSPAIWPGR
RIQLTEHPQASLNREWQVVSSDLHGSQPQAAAGRSGSGTSLENHFTVIPADRTWRPRPLP
KPSVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNPANQDSSCWIRVVQAWAGPGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRSPGSLPGTKTQMTIRSKTYKGSGFN
ELMFDDATGKERVYIHAQKNMNTEVLHNRTTDVTNNHAETIGNNQVIAVTNNQIQTIGVN
QIQNVGVNQVEKVGSNQVIKVGTNQIETVGLLRALNVGVVYQTTVGAIMNTSVAMMQSSQ
VGLHKSLMVGMGYSVNVGNKVTFSVGKTRSDNAGQTAIYSAGEHLELRCGKARLVMTKDG
KIFLNGTKIDLEGAESVNGDALTINWNCGATETVPDAPKDDSPEPKMPDMRKF
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaggattacgtttcacactggaggtggacggcctgccaccggatgcgctggtc
gtggagtcctttcacctgagccagtccctttccacgttattttccctcgatatctcgctg
gtcagccagcagctgcttaatattgacttctcccaggtactggaacaaccggcgcacctg
aaaatctggcagggcacggagatacagcgccgggtgaacggcatcgtgacctggtttgag
cagggggaaaacgacggacaccagatgctgtacagcatgaaagttcgcccgccggtgtgg
cgcgccgcgctgcgccagaactcgcgtattttccagaacgaagacataaaaagcattctc
gggacgatactgcaggaaaacggcgtgacggactggagcccgctgttcagcgagccgcat
ccggcgcgggagttctgcgtgcagtacagcgaaacggattacgactttctggcgcggatg
gcggcggaggaaggtattttcttttacgaggaacatgcgcagaccagcgacgaccagagc
ctggtgctgtgcgacacggtgcgttttctgccggaagcctttgaaatcccatggaacccg
aacacccgcaccgaggtgagcacgccgtgcgtcagccagttccgccacagcgcgcaaatc
cgcccctcctccgtcatcggcaaggactacaccttcaaacgccccggctgggcaggccgc
tttgagcatcagggtgaacatcaggattaccagcgcacgcagtacgaggtgtttgactat
ccggggcgcttcaaggacggccacggtcagaacttcacccgctggcagatggagggctgg
cgtaataatgccgaagtggcgcaggggaaaagccgttcgccggcgatatggccgggacgg
cgtattcagctgacggaacacccacaggcgagcctgaaccgggaatggcaggtggtgagc
agtgatttacacggcagccagccgcaggcggcggcggggcgttcaggctccgggacgagc
cttgaaaaccattttacggtcattccggcggacaggacatggcggccacgcccgctgccc
aaaccgtcagtggacggcccgcagtcggcagtggtcaccggcccggaaggggaagaaatc
ttctgcgacgaacatgggcgggtacgggtgaaatttaactgggaccggtataacccggcg
aaccaggacagctcgtgctggatacgggtggtacaggcgtgggcggggccggggttcggc
aacctggcgataccgcgggtggggcaggaagtgatagtggacttcctcaacggcgacccg
gaccagcccatcatcatggggcgcacctaccaccaggaaaaccgctcgccgggcagcctg
ccgggcactaaaacgcagatgaccatccgctcgaaaacctataaaggcagcgggtttaac
gaactcatgttcgatgatgcgacagggaaggagcgggtgtatatccacgcgcagaagaac
atgaataccgaggtgctgcacaaccgcaccaccgatgtgacgaataaccatgctgaaacc
attggcaataaccaggtgatcgctgtcaccaataaccagatacagaccatcggcgtcaac
cagatccagaacgttggcgtcaaccaggtggagaaagtgggcagcaatcaggtgatcaag
gtggggacaaaccagattgaaacggtgggactcctccgcgccctgaatgtgggcgtggtg
taccagactacggtgggcgccattatgaacacctcagtggccatgatgcagtcttcacag
gtgggcctgcataaatcgctgatggtggggatggggtacagcgttaatgtggggaacaaa
gtcaccttctcggtggggaaaacaaggtcagacaatgccgggcagacagcgatttattct
gcgggtgaacatctggagcttcgctgcggtaaagcccggctggtaatgacgaaggacgga
aaaattttccttaacggaacgaaaattgatctggaaggtgcggaaagcgtcaatggtgat
gcgctgacgatcaactggaactgcggcgcaacagaaaccgtgccggatgcgccgaaggat
gactcgccggagccgaagatgccggatatgaggaagttctga

DBGET integrated database retrieval system