KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B1230Help
Entry
SeAg_B1230        CDS       T00751                                 

Gene name
ruvB
Definition
(GenBank) holliday junction DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sea00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SeAg_B1230 (ruvB)
Enzymes [BR:sea01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SeAg_B1230 (ruvB)
DNA repair and recombination proteins [BR:sea03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SeAg_B1230 (ruvB)
    RecFOR pathway proteins
     SeAg_B1230 (ruvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvB_N RuvB_C AAA AAA_5 AAA_22 Mg_chelatase AAA_3 Sigma54_activat TIP49 AAA_16 Rad17 AAA_14 AAA_18 NTPase_1 RNA_helicase Bac_DnaA AAA_24 TsaE T2SSE AAA_17 IstB_IS21 AAA_33 HTH_15 AAA_28 NB-ARC ABC_tran
Motif
Other DBs
NCBI-ProteinID: ACH48707
UniProt: B5F3J7
Position
1214538..1215548
Genome map
AA seq 336 aa AA seqDB search
MIEADRLISAGATIAEDVADRAIRPKLLAEYVGQPQVRSQMEIFIQAAKRRGDALDHLLI
FGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSP
VVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQR
LEFYQVPDLQHIVGRSARHMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDG
AISAEIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDV
LEPYLIQQGFLQRTPRGRMATVRAWNHFGITPPEMP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagcagatcgcctgatttcagcaggcgccacgatcgcagaagacgtcgccgat
cgcgccattcgcccgaagttattggcggaatatgtcggccaaccgcaggtgcgctcccag
atggagatctttattcaggcggcaaaacggcgtggcgacgcactagatcacttgctgatt
ttcggcccgccagggttaggtaagacgactctggcgaatatcgttgccaatgaaatgggc
gtcaatctccgaaccacgtccggcccggtgctggaaaaagcaggcgatctggcggctatg
ctcaccaatcttgaaccgcatgatgtgctgtttattgatgagattcaccggctttcaccg
gtggtggaagaggtactctatccggcgatggaagattaccagttggatattatgattggc
gaagggcctgctgcacgttcaattaagatcgatctgccgccgtttacgctcattggcgcg
acgacgcgagcaggttcgctgacctcgccgctacgtgaccgttttggtattgtgcagcgc
ctggagttctaccaggtgcccgatctgcagcacatcgtcgggcgcagcgcaaggcacatg
gggcttgagatgagtgatgacggcgcgctggaagtggcgcgtcgggcgcgcggtacgccg
cgtatagccaaccgcctgctcagacgtgtgcgtgatttcgccgaggtgaagcatgacggg
gctatttcagcggaaattgccgcgcaggcgctggatatgctgaacgtcgatgcggaaggg
tttgactatatggatcgcaagctgctgctggcggttattgataaattcttcggtggtccg
gtgggactggataacctggcggcggcgattggcgaagagcgtgaaaccattgaggatgtg
ctggagccgtatctgattcagcaaggctttttgcagcgtacgccgcgtgggcgtatggca
acggtgcgcgcctggaaccatttcgggatcacgccgccagagatgccttag

DBGET integrated database retrieval system