KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B3125Help
Entry
SeAg_B3125        CDS       T00751                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Brite
KEGG Orthology (KO) [BR:sea00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sea03009]
    SeAg_B3125
Enzymes [BR:sea01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     SeAg_B3125
Ribosome biogenesis [BR:sea03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SeAg_B3125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222
Motif
Other DBs
NCBI-ProteinID: ACH52572
UniProt: B5F4S7
Position
complement(3050194..3051294)
Genome map
AA seq 366 aa AA seqDB search
MNKVVLLCRPGFEKECAAEITDKAGKREIFGFARVKENAGYVIYECYQPEDGEKLISELP
FSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELMKFC
RKFTVPLRAALRDAGVLTNYETPKRPVVHVFFIAPGCCYTGYSLAHNNSPFYMGIPRLKF
PSDAPSRSTLKLEEALHVFIPEDEWDERLANGMYAVDLGACPGGWTYQLVKRNMWVYSVD
NGPMAQSLMDTGQVTWLREDGFRYRPNRNNISWMVCDMVEKPAKVTALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSHNLAYLQAQLDEHGVNAQIQARQLYHDREEVTVHVRRLWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagttgtattgctctgccgtccggggtttgaaaaagagtgcgctgcagaaatt
accgataaagcgggaaaacgggaaatatttggttttgcacgcgtaaaagagaacgcaggc
tatgtcatttatgaatgctaccagccggaagatggcgaaaagctgatttcagaactgccg
ttcagttcgctgattttcgcccgccagtggtttgtggtgggtgaactgctgcaacattta
ccgccggaagaccgaattacgccgattgtcggcatgttgcagggcgtagtggaaaagggc
ggcgagctgcgcgttgaagtcgccgataccaatgaaagtaaagaactgatgaagttctgc
cgcaaatttacggtgccgctgcgcgcggctttgcgtgatgcgggcgtattgacgaattat
gaaacgccgaagcgtccggtcgttcatgtcttttttatcgcgccaggatgctgctatacc
ggttattcgctcgcgcataacaattcaccgttttatatgggcatcccgcgtttgaagttt
ccgtctgatgcgccgagccgctcaacgctgaaactggaagaggcgctccacgttttcatc
ccggaagatgagtgggatgaacgtctggcgaacggcatgtatgcggtggatttgggcgcc
tgtcccggcggatggacgtaccagttagtgaagcgcaatatgtgggtctactccgtagat
aacggcccgatggcgcaaagcctgatggacaccggacaggtgacctggttgcgtgaggat
ggcttcaggtaccgtccgaaccggaataatatttcatggatggtctgcgatatggtggag
aagccggccaaagtcaccgcgttaatggcgcagtggctggtgaacggctggtgtcgggag
acgatttttaaccttaaactgccgatgaaaaaacgctatgaagaggtatcgcataatctg
gcgtatcttcaggcgcagttggatgagcatggcgttaatgcgcagatccaggcgcgtcag
ctttatcacgatcgcgaagaagtgacggtgcacgtgcgtcggttgtgggcggctgttggc
ggacgtcgcgacgagcgataa

DBGET integrated database retrieval system