KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B3171Help
Entry
SeAg_B3171        CDS       T00751                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea00071  Fatty acid degradation
sea00280  Valine, leucine and isoleucine degradation
sea00310  Lysine degradation
sea00362  Benzoate degradation
sea00380  Tryptophan metabolism
sea00620  Pyruvate metabolism
sea00630  Glyoxylate and dicarboxylate metabolism
sea00640  Propanoate metabolism
sea00650  Butanoate metabolism
sea00900  Terpenoid backbone biosynthesis
sea01100  Metabolic pathways
sea01110  Biosynthesis of secondary metabolites
sea01120  Microbial metabolism in diverse environments
sea01130  Biosynthesis of antibiotics
sea01200  Carbon metabolism
sea01212  Fatty acid metabolism
sea02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeAg_B3171
   00630 Glyoxylate and dicarboxylate metabolism
    SeAg_B3171
   00640 Propanoate metabolism
    SeAg_B3171
   00650 Butanoate metabolism
    SeAg_B3171
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SeAg_B3171
   00072 Synthesis and degradation of ketone bodies
    SeAg_B3171
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SeAg_B3171
   00310 Lysine degradation
    SeAg_B3171
   00380 Tryptophan metabolism
    SeAg_B3171
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SeAg_B3171
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SeAg_B3171
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SeAg_B3171
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sea04147]
    SeAg_B3171
Enzymes [BR:sea01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SeAg_B3171
Exosome [BR:sea04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SeAg_B3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACH50987
UniProt: B5F4W6
Position
complement(3097087..3098265)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtactgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattaccattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttatcgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcctattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system