KEGG   Salmonella enterica subsp. enterica serovar Agona SL483: SeAg_B4535Help
Entry
SeAg_B4535        CDS       T00751                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sea  Salmonella enterica subsp. enterica serovar Agona SL483
Pathway
sea00010  Glycolysis / Gluconeogenesis
sea00620  Pyruvate metabolism
sea00640  Propanoate metabolism
sea00680  Methane metabolism
sea01100  Metabolic pathways
sea01110  Biosynthesis of secondary metabolites
sea01120  Microbial metabolism in diverse environments
sea01130  Biosynthesis of antibiotics
sea01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sea00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeAg_B4535 (acsA)
   00620 Pyruvate metabolism
    SeAg_B4535 (acsA)
   00640 Propanoate metabolism
    SeAg_B4535 (acsA)
  Energy metabolism
   00680 Methane metabolism
    SeAg_B4535 (acsA)
Enzymes [BR:sea01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SeAg_B4535 (acsA)
Lipid biosynthesis proteins [BR:sea01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SeAg_B4535 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACH51127
UniProt: B5F2F1
Structure
PDB: 

Position
complement(4433345..4435303)
Genome map
AA seq 652 aa AA seqDB search
MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYRELHRDVCRF
ANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacacataaacacgccattcccgccaacattgcggatcgttgcctgataaat
ccagagcagtatgagactaaatataaacagtctattaacgaccccgatacgttttggggc
gaacagggaaaaattctcgattggatcacgccgtaccaaaaagtgaaaaacacctccttt
gcgccaggcaatgtgtcgattaaatggtacgaggacggcacgctgaatctggcggcgaac
tgtcttgaccgccatttgcaggaaaatggcgatcgcaccgccattatctgggaaggcgat
gacgcgtcgcagagtaaacatatctcttatcgcgaactgcatcgcgatgtctgccgtttc
gcgaatacgctgctggatctgggcattaaaaaaggcgatgtggtagcgatttatatgccg
atggtgccggaagcggcggtggcaatgttggcctgcgcccgcatcggtgcggtgcattcg
gtgatcttcgggggcttctcgccggaagccgtcgccggacgcattatcgactccagttcg
cggctggtgatcaccgctgacgaaggtgtacgtgccggacgcagtatcccgctgaaaaag
aatgtcgatgacgcgctgaaaaacccgaatgtcactagcgttgagcatgtgatcgtcctg
aagcgcaccggcagcgacattgactggcaagaaggccgcgacctgtggtggcgcgatttg
attgaaaaagccagccctgagcaccagcctgaagcgatgaatgccgaagatccgctgttt
atcctttatacctccggctccaccggcaagccgaaaggcgtgctgcacaccaccggcggt
tatctggtctacgccgcgaccacctttaagtatgtctttgattatcaccctggcgatatt
tactggtgtaccgccgatgtgggttgggtgacggggcacagctatctgttgtatggcccg
ctggcctgcggcgcgaccaccttaatgtttgaaggcgtgccgaattggccaacgcccgct
cgcatgtgccaggtggtcgacaaacaccaggtcaacattctctataccgccccgacggcc
atccgcgcgctgatggcggaaggcgataaagccattgaaggcaccgaccgttcttcacta
cgcattctgggttccgtcggcgagccgatcaatcccgaagcgtgggaatggtactggaag
aagatcggcaaggaaaaatgtccggtcgtcgacacctggtggcagactgaaacaggcggt
tttatgatcacgccgctaccgggcgctatcgaactgaaagccggttccgccacccgtcct
ttctttggcgtacagcctgcgctggtggataacgaaggccatccgcaagaaggcgcgacg
gaaggcaatctggtcatcaccgattcctggccgggccaggcgcgcactctgttcggcgat
catgaacgttttgagcagacctatttctctacctttaagaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagacggctattactggatcaccggtcgcgtggatgacgtgtta
aacgtctccggccaccgtctgggtacggcggaaatcgagtcagcgctggtggcgcatccg
aagatcgccgaagcggcggtggtgggtattccacacgctatcaaaggccaggcgatttac
gcttatgtgacgctcaaccacggcgaggagccgtcgccagaactgtacgcggaggtgcgc
aactgggtacgtaaagagattggcccactggcgacgccggacgttctgcactggaccgac
tcactgccaaaaacccgttccggcaaaattatgcgccgcattttgcgcaaaatcgcggcg
ggcgataccagcaatctgggcgatacctcgactctcgccgatcctggcgtggtggagaaa
ctgctcgaagagaagcaggccatcgcgatgccgtcataa

DBGET integrated database retrieval system