KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_0283
Entry
STM474_0283       CDS       T01760                                 

Definition
(GenBank) putative chaperone ATPase
  KO
K11907  type VI secretion system protein VasG
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:seb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STM474_0283
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:seb02044]
    STM474_0283
Secretion system [BR:seb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STM474_0283
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 AAA_22 Sigma54_activat AAA_7 NACHT TniB Zeta_toxin AAA_25 AAA_18 ATPase_2 T2SSE Hpr_kinase_C SRP54 AAA_6 P33MONOX AAA_30
Other DBs
NCBI-ProteinID: ADX16016
UniProt: E8XIT6
Position
311185..313824
AA seq 879 aa
METPVSRSALYGKLAGPLFRSLESATAFCKLRSNPWVELTHWLHQLTQQPDNDILHVLRH
YQIPLSDVEKALLRQLDMLPAGASAISDFSHHIDLSVEKAWMLASVRYGDNKIRSGWLLL
ALLTTPELRRVLSSICAPLATLPVDELTEILPSLIETSPEAQERPYDGSGLASAIPGESS
QAIPNGGQDGKSALAKYCQDMTAQARDGKIDPVTGREHEIRTMTDILLRRRQNNPLLTGE
AGVGKTAVVEGFALAIAQGEVPPALREVRLLALDVGALLAGASMKGEFESRLKGLLEEAG
RSPQPVILFVDEVHTLVGAGGASGTGDAANLLKPALARGTLRTIGATTWSEYKRHIEKDP
ALTRRFQVLQIAEPEEIPAMEMVRGLVDTLEKHHNVLILDEAVRAAVQLSHRYIPARQLP
DKAISLLDTAAARVALTLHTPPASVQFLRQQLKAAEMERSLLQKQEKMGIQSDERRDALM
ARIFSLNNELTASESRWQRELELVHTLQELRLAESDADDKTTLQQAETALREWQGDAPVV
FPEVSAAVVAAIVADWTGIPAGRMVKDEASQVLELPARLAQRVTGQDGALAQIGERIQTA
RAGLGDPRKPVGVFMLAGPSGVGKTETALALAEAIYGGEQNLVTINMSEFQEAHTVSTLK
GAPPGYVGYGEGGVLTEAVRRHPWSVVLLDEIEKAHHDVHELFYQVFDKGGMEDGEGTHV
DFKNTTLLLTTNVGSDLISQMCEDPALMPDATGLKEALMPELRKHFPAAFLGRVTVIPYL
PLDETSRGVIARLHLDRLVARMSEQHGVTLTYSEELVAHIVACCPMHETGARLLIGYIEQ
HILPRLSRYWLQAMTEKAAIRQIDIGVNGDEQIVFEIVC
NT seq 2640 nt   +upstreamnt  +downstreamnt
atggaaactcctgtttcacgcagtgcgttgtatggaaaactggccggcccactattccgg
tcgctggaatcggcaacggcattttgcaaactacgctctaatccctgggttgagctgact
cactggctgcaccagttaacacagcagcccgataacgatattctccacgttcttcggcat
taccagatccctctttctgatgtggagaaagcgttactccggcaactggatatgctgccc
gccggggccagcgccattagtgatttttctcaccatatcgatctcagcgttgaaaaggcc
tggatgctggcgagcgtccgttacggcgataacaaaattcgcagcggctggttgctgctg
gccttgttgaccacgccagaactgcgtcgggtactgagcagtatctgcgcgccgctggcc
acgcttccggttgatgaactgacggaaatactgccctcgttgatcgaaacatcgccggaa
gcgcaggagcgcccttacgacggctccggcctggcatcagccattcccggtgaaagcagt
caggcgattcccaacggcgggcaggacggtaaatccgcgctggcaaaatactgtcaggac
atgacggcacaggcgcgcgacggcaaaatcgacccggtgacggggcgtgagcatgaaatc
cgcaccatgacggatattctgctgcgccgtcgccagaataatccactactgactggtgag
gcgggcgtcgggaaaacggcggtcgtcgaaggttttgccctcgcgattgcgcagggggaa
gtgccgcccgcgctgcgggaagtacggctactggcgctggacgttggcgctctgttggcc
ggagccagcatgaaaggcgagtttgaatcgcgtctgaaagggttactggaagaggccggg
cgctcgccgcagccggttattctgtttgttgatgaagttcacactctggtgggcgcgggc
ggcgcatccggcacgggcgatgccgctaacctgctgaaaccggcgctggcgcgcggcacc
ctgcggactatcggcgccaccacctggagcgaatacaagcgccatattgagaaagatccg
gcgctgacccgtcgttttcaggtgttgcagattgccgaaccggaagagatccccgcaatg
gaaatggtgcgtggtctggtggatacgctggaaaaacaccataacgtactgattctggat
gaggcggtacgtgcggcggtacagctttctcaccgctacattcccgcccggcagttgccg
gataaggccatcagcctgctggataccgccgcggcccgcgtggcgctgacgctgcacacg
ccgcctgccagcgtacagttcctgcgccagcagctaaaagcggcggaaatggaacggtcg
ctgttgcagaagcaggaaaaaatggggattcagtcagatgagcggcgcgatgcgctgatg
gcgcgaattttctcgctcaacaatgaactgactgcatccgaatcccgctggcagcgggag
ctggaactggtacatacgttgcaggaactgcgtctcgcagagtctgatgctgatgacaaa
accacgctgcaacaggccgaaacggcgctaagggagtggcagggcgacgcgccggtggtg
ttcccggaagtcagcgcggcggttgtcgcggcgattgtcgccgactggaccggtattcct
gctgggcgcatggtgaaagatgaggccagccaggtgctggaactgcctgcccgactggcg
caacgcgttaccgggcaagacggcgcgctggcgcagattggtgaacgtattcagaccgcc
agggcgggactgggcgatccacgcaaaccggtgggcgtgtttatgctggccgggccgtcc
ggtgtcggtaaaaccgaaaccgcgctggcgctggcggaggctatctacggcggcgagcag
aacctggtaaccatcaatatgagcgagttccaggaggctcacaccgtttccacgctgaaa
ggcgcgccgcccggctatgtgggctatggcgagggtggtgtgctgacggaagcggtgcgt
cgccacccctggagcgtagtgctgctcgacgagatcgaaaaagcgcaccatgacgtccac
gaactcttctatcaggtgtttgacaagggtgggatggaggacggcgagggtacacatgtc
gatttcaaaaacaccacgctattactcaccaccaacgtgggttccgacctcatcagccag
atgtgtgaagatccggccttaatgcccgatgctacggggcttaaagaggcgctaatgccg
gaattgcgcaagcatttcccggcggcatttctgggccgcgtgacggtgatcccttacctg
ccgctggacgaaacgtcgcgtggcgtgattgcccgtctgcaccttgaccggctggtggcg
cggatgagtgaacagcacggcgtgacgctgacgtatagcgaggaactggtcgcacatatt
gtggcgtgctgtccaatgcatgaaacgggcgcgcggttgctgattggctacatcgaacag
cacattctgccacgactgtcgcgctactggttgcaggccatgacggaaaaagccgcgatc
aggcagattgatatcggcgttaatggtgatgagcagattgtttttgagatcgtttgctga

DBGET integrated database retrieval system