KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_0301Help
Entry
STM474_0301       CDS       T01760                                 

Definition
(GenBank) Rhs-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:seb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STM474_0301
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:seb02044]
    STM474_0301
Secretion system [BR:seb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STM474_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD T3SSipB
Motif
Other DBs
NCBI-ProteinID: ADX16034
UniProt: E8XIV4
Position
329849..332038
Genome map
AA seq 729 aa AA seqDB search
MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAESAVEQAAGSLFGALPEP
SGLVKAAVAAAQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGG
ETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTA
ARVVGHEGRSVTYELRMEPWVKLLTHTSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVES
YPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLVLADAISAHKACPDSPLVEW
HQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRETGHATYEHYEW
PGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQE
IWTDQYGRVKVQFGWDRYGKMDENSTCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGD
PDLPIIVGRTYNQDTMPPWGLPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHA
EKDLNTTVKNNETHTVMVDRTKTIIKNETNSIGEDRNTTVTKNDGLSVKLAQTINIGTTY
RLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVMQLIGKGIDMNPDGGTAVTAD
DIAPLLTSE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgtatccacaaataataaatccggtatgggagggctgacgacaaccacgccg
ccgataaccggagaaagtggcggtgtcaccgcagattcagtcgccggaagcgtggcagat
gcggcggaatccgccgtggaacaggctgcgggatcgctatttggcgcattgccggagcca
tcaggactggtgaaagccgcggtagcagcggcgcaggctgccgccgccgcaggtatggcg
caggatgcggtatcggccatcgtctctgctgttgcaggcgggccgggggcgcataatgtg
acggtcagcggcagcgccgtaccgccgggcgcattactgttcgccagcctggacggcggc
gaaacattaagtgaactgttcagctatgtggtacagctaaaaacgcccgacaccctgaat
ctgggctatgtctccccggcggccaacctgccgctcaaaccgatggtgggcaaagatctg
tgcgtcaacatcgaactggatggtggcggtaaacgacatatcagcgggctggtcacggcg
gcgcgggtggtgggccatgaagggcgttcggttacctatgagctgcgtatggagccgtgg
gtaaaactgctgacccataccagcgactacaaagcattccagaataaaaccgtggtggat
attctggatgaggttctggcggaatatccctacccggtggaaaagcggctggtggaaagc
tacccggtacgcacctggcaggtgcagtacggtgaaactgattttgattttcttcagcga
ctgatgcaggagtggggcatctactggtggtttgagcacagcgaggacagccacacgctg
gtgctggcggatgccatcagcgcccacaaagcatgtccggactcgccgctggtcgagtgg
caccaggaagggctgaagctggacaaggagtttatccacactatcacggcaaacgagagc
ctgcggactggacagtgggtgctggatgatttcgattttacgaagccacgttcattgctg
gcaaacaccgtggcaaacccgcgtgaaaccggtcatgccacctacgagcattatgagtgg
ccgggagactacttcgacaagagtgaaggcgagatgctgacgcgcattcgtatggaagcg
cagcgcagccccggcagtcgggtgctggggggagggaatatccgcacactcatgaccggt
tataccttcacgctggaaaactatcccaccgccgaagtcaatcaggaatatctgctgatg
cagaccttgctgtttgtgcaggacaacgcgcagcacagcgggcaggaccagcactttacc
ttttccacccgttttgaactgcaccccacccgcgaggtgttccgcccgcagcggacggtg
agcaaaccccacaccaaagggccgcagagcgccatcgtcaccggcccggcgggccaggaa
atctggacggatcagtacgggcgggtaaaggtacagtttggttgggatcgctacggcaaa
atggatgaaaacagcacctgctggatacgcgtcagctacccgtgggcgggcaaaggcttc
gggatgatccagatcccgcgtatcggccaggaagtgctggtggatttcaaaaacggcgat
ccggatctgccgatcatcgtggggcgtacctacaaccaggacaccatgccgccgtgggga
ctgccgggaatggcgtcgcagagcgggatcttcagccactcgctgtatggcgggccaacg
aacggcaacatgctgcgttttgacgacaaaacgggcgcggaggaagtgaagttccacgcg
gaaaaagatctcaacaccacggtgaagaataatgaaacgcatacggttatggtggatcgc
actaaaaccattattaaaaatgaaaccaacagtattggtgaggacagaaacaccacggta
acgaagaatgacggcctttccgtaaaactggcgcagacgatcaatatcggcaccacttat
cgtttagatgttggcgatcaattcacgcttcgctgcggcaatgcggcgcttgttttacat
aaggacggctccattgagttttgtggcaagcaactgatgttacataccagcgatgtcatg
caactgattggtaaaggtattgatatgaacccggatggcggcacagccgtaaccgccgat
gatattgccccccttctcacctctgagtga

DBGET integrated database retrieval system