KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_0921Help
Entry
STM474_0921       CDS       T01760                                 

Gene name
ltaA
Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00260  Glycine, serine and threonine metabolism
seb01100  Metabolic pathways
seb01110  Biosynthesis of secondary metabolites
seb01120  Microbial metabolism in diverse environments
seb01130  Biosynthesis of antibiotics
seb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:seb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STM474_0921 (ltaA)
Enzymes [BR:seb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     STM474_0921 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ADX16631
UniProt: E8XCP2
Position
complement(965604..966605)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEAMMTAPVGDDVYGDDPTVNALQRYAADLSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGTLPLENVAAKI
KADDIHFARTRLLSLENTHNGKVLPRAYLKDAWTFTRERGLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRATRWRKMVGGGMRQAGILAAAGLY
ALKHNVARLQEDHDNAAWLAQQLREAGAEVIRHETNMLFVRVGEAQAAALGDYLRERNIL
INAAPIVRLVTHLDVSREQLTDVVAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgggccgcgccatgctcgaggcgatg
atgaccgccccggtcggggacgacgtatacggcgatgaccctactgttaacgcccttcag
cgctacgccgccgacctttccggtaaagaagcggcgctttttttacccaccggcacccag
gccaatctggtcgcgctgcttagccattgtgaacgcggcgaagagtatatcgtcggtcag
ggcgcgcataattatctctatgaagctggcggcgcggcggtgctcggcagcattcagccg
cagcccatcgacgccgccgcggacggtacgctgccgctggagaacgtggcggcgaagatt
aaagcggatgacatccacttcgcgcgcacgcgcttgctcagtctggaaaatacgcataac
gggaaagtgctgccgcgcgcgtatctgaaagacgcctggacatttacccgcgaacgtgga
ctggcgctgcacgttgacggcgcccgaatttttaacgcggtggttgcctacggctgtgag
ttaaaagagattacgcagtattgcgactcttttaccatctgcctgtcaaaaggtctcgga
acgccggtcggttcactgctggtcggcaaccgcgattacattaaacgcgcgacgcgctgg
cgtaaaatggtcggcggcggaatgcgtcaggccgggattctggcagcggccggactgtat
gcgctgaagcataacgtggcgcgtctgcaagaggatcatgataacgccgcctggctggcg
cagcagcttcgggaagcgggcgcggaggtcatacgccacgaaacgaatatgctgtttgtt
cgcgttggcgaagcacaggccgccgcgcttggcgactatttgcgggaacggaatatcctg
attaacgccgcgccgattgtgcgtctggtgacgcatctggatgtctctcgcgaacagctt
accgacgtcgtcgcccactggcgcgcctttttagcccgctaa

DBGET integrated database retrieval system