KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_2586Help
Entry
STM474_2586       CDS       T01760                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00300  Lysine biosynthesis
seb01100  Metabolic pathways
seb01120  Microbial metabolism in diverse environments
seb01230  Biosynthesis of amino acids
Module
seb_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STM474_2586 (dapE)
Enzymes [BR:seb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     STM474_2586 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ADX18243
UniProt: E8XFU2
Position
2595410..2596537
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQNFWAWRGRGET
LAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPH
HRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacagcaacttattcgtcgcccctccctgagtccg
gatgacgcaggctgtcaggcattaatgattgaacgcctgcgtaaaatcggttttaccatt
gagcatatggattttggcgacacgcaaaatttttgggcatggcgtgggcgtggcgaaacg
ctggcgttcgccgggcatactgacgtcgtaccggctggcgatgtcgatcgctggatcaat
ccgccgtttgagcctacgattcgcgacggaatgttgttcggtcgcggcgcggcggatatg
aaaggttcactggcggccatggtggtggctgctgaacgttttgttgcgcagcatcctcat
caccggggccgcctcgcatttttgattacctctgatgaggaagccagcgcaaaaaatggc
accgtaaaggtggttgaagcgctgatggcccgtaacgagcggctggattactgtctggtc
ggcgaaccttccagtactgaaattgtgggcgatgtcgtcaaaaacgggcgtcgcggttct
ctcacctgtaacctcactatccatggcgttcaggggcacgtcgcctatccgcatctggcg
gataaccctgttcatcgcgccgcgccttttcttaatgaactggtcgctatcgagtgggat
cggggcaatgactttttcccggccaccagtatgcaggtagccaatatccaggcaggcacc
ggcagcaataatgtcattcccggcgaactgttcgtgcagtttaacttccgtttcagcacg
gaactgaccgatgagatgatcaaagagcgggtacatgcgctgcttgaaaagcatcagcta
cgctataccgtagactggtggctttccgggcagccgttcctgaccgcacgcggcaagctg
gtggacgcggtggtaaacgccattgagcactataatgaaattaaaccgcaattactgacg
acgggcggtacgtccgacggacgttttatcgcccgtatgggagcgcaggtggtagaactg
gggccggtgaacgccaccattcataaaattaatgaatgtgtgaatgccgccgatctccag
ctactggcccgtatgtatcaacgcattatggaacagctcgtcgcctga

DBGET integrated database retrieval system