KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_2628Help
Entry
STM474_2628       CDS       T01760                                 

Gene name
ndk
Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00230  Purine metabolism
seb00240  Pyrimidine metabolism
seb01100  Metabolic pathways
seb01110  Biosynthesis of secondary metabolites
seb01130  Biosynthesis of antibiotics
Module
seb_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
seb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
seb_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
seb_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:seb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STM474_2628 (ndk)
   00240 Pyrimidine metabolism
    STM474_2628 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:seb04131]
    STM474_2628 (ndk)
Enzymes [BR:seb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     STM474_2628 (ndk)
Membrane trafficking [BR:seb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    STM474_2628 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ADX18284
UniProt: E8XGL5
Position
complement(2657786..2658217)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPNAVAKNVIGSIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF
DGLVEFMTSGPIVVSVLESENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD
SLESAQREIAFFFGEGEVCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaacggactttttccatcattaaacccaacgcggtggcaaaaaacgttatt
ggcagcatctttgcgcgctttgaagctgcagggttcaaaattgttggcactaaaatgctg
cacctgaccgttgagcaggcgcgcggcttctatgctgagcacgacggcaagccgttcttt
gacggtctggtggagttcatgacctctggccctatcgtggtatccgtgctggaaagtgaa
aatgcggtacagcgtcaccgcgatctgcttggcgccaccaatccggcgaacgcgttggcg
ggtacgctgcgcgccgactacgctgatagcttaactgaaaacggcacccacggttcggat
tcgctggaatccgcgcagcgcgaaatcgcctttttcttcggtgaaggcgaagtgtgcccg
cgcacccgttaa

DBGET integrated database retrieval system