KEGG   Salmonella enterica subsp. enterica serovar Typhimurium ST4/74: STM474_4373Help
Entry
STM474_4373       CDS       T01760                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
seb  Salmonella enterica subsp. enterica serovar Typhimurium ST4/74
Pathway
seb00630  Glyoxylate and dicarboxylate metabolism
seb01100  Metabolic pathways
seb01110  Biosynthesis of secondary metabolites
seb01120  Microbial metabolism in diverse environments
seb01200  Carbon metabolism
Module
seb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:seb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STM474_4373 (aceA)
Enzymes [BR:seb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     STM474_4373 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADX19948
UniProt: E8X8U1
Position
4424947..4426266
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELQKEWTQPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKMWR
LLHGEAKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPAN
SVPAVVDRINNTFRRADQIQWASGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDA
DAADLITSDCDPYDSGFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ELARRFADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTII
QGGASSVTALTGSTEEAQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtactcaacaaatcgaagaattacagaaagagtgg
acacaaccgcgctgggaaggcatcacccgcccgtacagcgcggaggaggtggtgaaatta
cgcggctcggttaacccggaatgcacgctggcgcagctcggcgccgcgaaaatgtggcgg
ctgttgcacggtgaagcgaaaaaaggctatatcaacagccttggcgcgctgaccggcggt
caggcgttgcagcaggcgaaagccggtattgaggcgatttatctttcaggctggcaggtg
gcggcagatgccaacctggcatccagcatgtatccggatcaatcgttgtacccggcaaac
tctgttccggcggtagtggatcggatcaacaacacttttcgtcgtgcagatcagatccag
tgggcatccggtattgaacccaacgatccgcgctatgtggattacttcctgccgatcgtt
gctgatgcggaagccggttttggcggcgttctgaatgccttcgaactgatgaaatcgatg
attgaagccggtgcagcggccgttcacttcgaagatcagctggcgtcggtgaagaaatgc
ggccatatgggcggcaaggtgctggtccccacgcaggaggcgattcagaaactggttgct
gcgcgtctggccgctgatgtgatgggcgtcccgacgctggtgattgcgcgtaccgatgcg
gatgcggcagatctgatcacctccgactgcgatccctatgacagcggttttattaccggc
gaacgcaccagcgaaggtttctaccgcacccatgcgggcattgagcaggcgatcagccgc
ggtctggcgtatgccccgtatgccgatctggtatggtgcgaaacctctacgccggatctc
gaactggcgcgtcgttttgccgatgctatccacgcgaagtatccgggcaaactgctggcc
tataactgttcaccatccttcaactggcagaagaatctggacgacaagaccattgccagc
ttccagcagcagttgtcggacatgggttacaaataccagtttattaccctggcgggcatc
cacagcatgtggttcaacatgttcgacctggcgcatgcatacgcgcagggcgagggcatg
aagcactatgttgagaaggttcaacaacccgagttcgccgcggcgaaagatggctacacc
tttgtttcccaccagcaggaagtgggtactggttacttcgacaaagtcaccaccattatt
cagggcggcgcgtcatccgttaccgcgttaacgggttccaccgaagaagcgcagttttga

DBGET integrated database retrieval system