KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_0042Help
Entry
SCH_0042          CDS       T00240                                 

Gene name
slpA
Definition
(GenBank) FKBP-type peptidyl-prolyl cis-trans isomerase (rotamase)
  KO
K03774  FKBP-type peptidyl-prolyl cis-trans isomerase SlpA [EC:5.2.1.8]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Brite
KEGG Orthology (KO) [BR:sec00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sec03110]
    SCH_0042 (slpA)
Enzymes [BR:sec01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SCH_0042 (slpA)
Chaperones and folding catalysts [BR:sec03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    SCH_0042 (slpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: AAX63948
UniProt: Q57TL3
Position
51598..52047
Genome map
AA seq 149 aa AA seqDB search
MSKSVQSNSAILVHFTLKLDDGSTAESTRNNGKPALFRLGDTSLSEGLEQQLLGLKEGEK
KAFSLEPDAAFGVPSPDLIQYFSRREFMAAGEPEVGAIMLFTAMDGSEMPGVIREINGDS
ITVDFNHPLAGHTVHFDIEVLEIDPALEA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatccgtacagagcaacagcgcgatcctcgttcacttcaccctgaaactggat
gatggctcaacggcggaatctacccgcaataacggcaagccagccctgttccgtcttggc
gatacctcgctttccgaaggtctggagcagcagcttctggggttgaaagaaggggaaaag
aaagcgttttcgctggagcctgacgccgcgtttggcgtccccagtccggacttgatccag
tatttctcgcgccgtgagtttatggcggcgggcgaaccggaagtcggggcgattatgctt
tttaccgcaatggatggcagcgaaatgcctggcgtgattcgcgaaatcaacggcgactcg
attaccgttgattttaaccatccgctggccgggcataccgttcactttgatattgaagtg
ctggaaatcgatccggcgctggaggcataa

DBGET integrated database retrieval system