KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_0123Help
Entry
SCH_0123          CDS       T00240                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
sec00471  D-Glutamine and D-glutamate metabolism
sec00550  Peptidoglycan biosynthesis
sec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sec00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SCH_0123 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCH_0123 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sec01011]
    SCH_0123 (murD)
Enzymes [BR:sec01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     SCH_0123 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:sec01011]
 Precursor biosynthesis
  Amino acid ligase
   SCH_0123 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AAX64029
UniProt: Q57TD2
Position
141732..143048
Genome map
AA seq 438 aa AA seqDB search
MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLDKLPQEVERHVGGLND
EWLLAADLIVASPGIALAHPSLSAAASAGVEIVGDIELFCREAQEPIVAITGSNGKSTVT
TLVGEMAKAAGVNVGVGGNIGLPALMLLDADRELYVLELSSFQLETTSSLQAAAATVLNV
TEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVRGADERCVSFGVNMGDYHL
NRQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALADAVGLPRASSLKALTTFTGL
AHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTLHLLLGGDGKSADFSPLTRYL
TGDRIRLYCFGRDGAQLAALRPEIAQQTETMEEAMRLLAPRVQPGDMVLLSPACASLDQF
KNFEQRGDVFTRLAKELG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggctgattaccaggacaaaaacgtcgtcattattggtctgggcttaaccggactctct
tgcgtggacttttttctcgcccgcggcgtgacgccgcgggtgatggatactcgcgtgacg
ccgccgggtctggataagctgccgcaagaggttgagcgtcacgttggcggcctgaacgac
gagtggctcttagcggcggatttaatcgtcgccagccctggtattgctctggcacatccc
tctcttagcgctgccgccagcgctggagtggaaattgtcggcgatatcgaactgttttgc
cgcgaagcgcaggagccgattgtggccatcaccggctcgaacggcaaaagcaccgtgacc
accttagtgggcgagatggcgaaagcggcgggcgtcaatgtcggcgttggcggcaatatc
ggtcttccggcgctgatgctgctggatgccgatcgcgaattgtacgtgctggaattatcc
agtttccaactggaaactacctcaagtttgcaagcggcggcggcaacggtgctcaacgtc
actgaagatcatatggaccggtatccgtttggtttgcaacagtaccgggcggcgaaactg
cgcgtctacgagaaggcgaaagtgtgcgtagtgaatgccgatgacgcgttgacgatgccg
gttcgcggggccgatgaacgatgcgtcagctttggcgtcaatatgggtgattatcacctt
aatcgtcagcagggcgaaacctggctgcgagtcaaaggcgagaaggtgctgaacgtgaaa
gagatgaagctttccggtcagcataactataccaacgcgttagcggcgctggcgctggcg
gatgccgtaggtctgccgcgcgccagcagtttgaaggcgttgacgacatttaccggtctg
gcgcatcgcttccagctggcgttggagcataacggcgtacgttggatcaacgactcgaaa
gcgaccaacgtcggcagtaccgaagcggcgctaaacggtttgcatgtggacggtacgcta
catctgctgctgggcggcgacggtaagtcggcagacttttctccgctgacacgctatctg
accggcgatcgtatccgcctgtattgctttgggcgcgatggcgcgcagcttgccgcactg
cgtccggaaatcgcccaacagactgagacgatggaagaggcgatgcgtttgctggcgccg
cgcgttcagccgggtgatatggtgctgctgtcgcccgcctgcgccagcctcgatcagttt
aaaaattttgagcaacggggcgatgtctttacccgtctggcgaaggagttaggttga

DBGET integrated database retrieval system