KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_2299Help
Entry
SCH_2299          CDS       T00240                                 

Gene name
yfbE
Definition
(GenBank) putative DegT/DnrJ/EryC1/StrS family
  KO
K07806  UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.87]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
sec00520  Amino sugar and nucleotide sugar metabolism
sec01100  Metabolic pathways
sec01503  Cationic antimicrobial peptide (CAMP) resistance
sec02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SCH_2299 (yfbE)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SCH_2299 (yfbE)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SCH_2299 (yfbE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sec01005]
    SCH_2299 (yfbE)
   01007 Amino acid related enzymes [BR:sec01007]
    SCH_2299 (yfbE)
Enzymes [BR:sec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.87  UDP-4-amino-4-deoxy-L-arabinose aminotransferase
     SCH_2299 (yfbE)
Lipopolysaccharide biosynthesis proteins [BR:sec01005]
 Unusual sugar
  SCH_2299 (yfbE)
Amino acid related enzymes [BR:sec01007]
 Aminotransferase (transaminase)
  Others
   SCH_2299 (yfbE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_1_2 SepSecS Beta_elim_lyase Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AAX66205
UniProt: Q57M57
Structure
PDB: 

Position
2418251..2419390
Genome map
AA seq 379 aa AA seqDB search
MSDFLPFSRPAMGAEELAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQYAVAVSSATAG
MHIALMALGIGEGDEVITPSMTWVSTLNMIVLLGANPVMVDVDRDTLMVTPEHIEAAITP
QTKAIIPVHYAGAPADLDAIYALGERYGIPVIEDAAHATGTSYKGLHIGARGTAIFSFHA
IKNITCAEGGIVVTDNPQFADKLRSLKFHGLGVDAWDRQSGGRAPQAEVLAPGYKYNLPD
LNAAIALAQLQKLDALNARRAAIAAQYHQAMADLPFQPLSLPSWEHIHAWHLFIIRVDEA
RCGITRDALMASLKTKGIGTGLHFRAAHTQKYYRERFPTLTLPDTEWNSERICSLPLFPD
MTESDFDRVITALHQIAGQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactttttgcctttctcccgtccggcgatgggcgcggaagagctcgctgccgtt
aagaccgtactggactcaggttggataacaaccggcccgaaaaatcaggaactggaagcg
gcattttgtcggctaacaggcaatcaatatgccgttgccgtcagttcagccactgccggt
atgcacatcgcgttgatggcgctgggcattggtgaaggcgacgaggtcattacaccgtca
atgacgtgggtttctacgctaaatatgatcgttttactcggcgcgaaccccgtcatggtc
gatgtcgatcgcgatacgctgatggtcacacctgaacatatcgaagccgcgattacgcca
caaaccaaagcaattatccccgtccactacgctggcgcgcccgccgatctggacgctatt
tacgctcttggcgagcgttatggcattccggtgattgaagacgcggcgcacgcgacagga
accagctacaaaggtctccacattggcgcccggggcaccgcgattttctccttccacgcc
attaagaacattacctgcgctgaaggcggtatcgtcgtcacggataacccgcaattcgcc
gataaactgcgcagtctcaagtttcacgggcttggcgttgatgcctgggatcgacagagc
ggaggacgcgcgccacaagcggaagtcctggcgccgggctacaaatataatttgcccgac
ctcaacgccgctatcgcgcttgctcagttacagaaactggatgcgcttaacgctcgccgc
gccgccatcgcagcgcagtaccaccaggcaatggcagacctgccttttcagcctctgagc
cttccgtcgtgggagcatattcacgcctggcatttattcattatccgggtcgatgaagcc
cgctgcggtattacccgggatgctctgatggcatcgctgaaaacgaaaggcatcggcaca
gggctgcatttccgcgccgcgcatacgcaaaaatattatcgcgaacgtttcccaacgctc
acgctgcctgacaccgagtggaacagcgaacggatctgctcactgccgctcttcccggac
atgaccgagagtgactttgatcgggtcattaccgcccttcatcagatagcaggacaataa

DBGET integrated database retrieval system