KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_2391Help
Entry
SCH_2391          CDS       T00240                                 

Gene name
yfcY
Definition
(GenBank) paral putative acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
sec00071  Fatty acid degradation
sec00280  Valine, leucine and isoleucine degradation
sec00281  Geraniol degradation
sec00362  Benzoate degradation
sec00592  alpha-Linolenic acid metabolism
sec01100  Metabolic pathways
sec01110  Biosynthesis of secondary metabolites
sec01120  Microbial metabolism in diverse environments
sec01130  Biosynthesis of antibiotics
sec01212  Fatty acid metabolism
Module
sec_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SCH_2391 (yfcY)
   00592 alpha-Linolenic acid metabolism
    SCH_2391 (yfcY)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCH_2391 (yfcY)
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SCH_2391 (yfcY)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCH_2391 (yfcY)
   00642 Ethylbenzene degradation
    SCH_2391 (yfcY)
Enzymes [BR:sec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SCH_2391 (yfcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAX66297
UniProt: Q57LW5
Position
complement(2514662..2515972)
Genome map
AA seq 436 aa AA seqDB search
MRQALPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVVGELLARSEIPADAIE
QLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQAVANVAESLMAGTIRA
GIAGGADSSSVLPIGVSKALARVLVDVNKARTTRQRLTLFSRLRLRDLLPVPPAVAEYST
GLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWAEGKLAEEVMTTYVPPYKNPFTE
DNNIRGTSTLADYAKLRPAFDRKHGSVTAANSTPLTDGAAAVILMTESRAKELGLRPLGY
LRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMADLTLFDMHEAFAAQTLANLQLLGSE
RFAREVLGRAQATGEVDDAKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT
ACAAGGLGAAMVLEAE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaggctttaccgttggtcacccgtcagggcgatcgcattgctattgtcagtggg
ttacgaacccccttcgctcgtcaggccactgcatttcatggtattcccgctgttgatctc
ggcaagatggtggtaggcgagctgctggcgcgcagtgaaattccagccgatgccattgag
caactggtttttggtcaggtagtacaaatgccggaagcccccaatattgcgcgcgaaatt
gtgctgggtacgggaatgaatgttcataccgatgcctatagcgtaagccgcgcctgcgcc
accagttttcaggcggtagcgaatgtggcggaaagcctgatggccggcacgatacgcgcg
ggtatcgctggcggcgcagattcgtcgtcggtactgccaataggcgtgagtaaagccctg
gcgcgggtactggttgatgtcaataaagcccggacgacccgccaacggctgacgcttttt
tctcgtctgcgcttacgcgacctgctgcccgttcctcccgccgttgctgagtattccacc
ggtctgcgcatgggcgataccgccgaacagatggcgaaaacgtatggtattacgcgtgaa
cagcaggacgcgctggcgcatcgttcacatcagcgcgctgcgcaggcatgggcggagggc
aaactggcggaagaagtgatgacgacctatgtgccgccgtataaaaacccctttacagaa
gacaacaacattcgcggcacctccacgctggcggactacgctaaactgcgtcccgctttt
gaccgaaaacatggctccgtaaccgccgccaacagtacaccgctgaccgacggcgctgcc
gccgttattctgatgaccgaatcccgcgctaaagagctggggctgcgcccgcttggttat
ctgcgcagctacgcctttaccgctattgatgtctggcaggacatgctattggggccggcc
tggtcaacgccgctggcgctggagcgggccgggttgacgatggccgatctgacgcttttt
gacatgcatgaagcgtttgccgctcagactctggcgaacttacaactgctgggcagcgaa
cgatttgcccgtgaggtgcttggtcgtgcgcaggcgacaggggaggtggatgacgctaaa
ttcaacgtgctcggcggctcaatcgcctacgggcatccttttgccgcaacgggcgcgcgg
atgataacccaaacgttgcatgaattacggcgtcggggcggaggttttggcctggtcacg
gcctgcgcggctggcggtcttggcgcggcgatggttctggaggcggaataa

DBGET integrated database retrieval system