KEGG   Salmonella enterica subsp. enterica serovar Choleraesuis: SCH_3724Help
Entry
SCH_3724          CDS       T00240                                 

Gene name
dsdA
Definition
(GenBank) D-serine deaminase (dehydratase)
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
sec  Salmonella enterica subsp. enterica serovar Choleraesuis
Pathway
sec00260  Glycine, serine and threonine metabolism
Brite
KEGG Orthology (KO) [BR:sec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCH_3724 (dsdA)
Enzymes [BR:sec01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     SCH_3724 (dsdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAX67630
UniProt: Q57I32
Structure
PDB: 

Position
3944108..3945430
Genome map
AA seq 440 aa AA seqDB search
MENIQKLIARYPLVEDLVALKETTWFNPGATSLAQGLPYVGLTEQDVNAAHDRLARFAPY
LAKAFPQTAAAGGMIESDVVAIPAMQKRLEKEYGQTIDGEMLLKKDSHLAISGSIKARGG
IYEVLTHAEKLALEAGLLTTDDDYSVLLSPEFKQFFSQYSIAVGSTGNLGLSIGIMSACI
GFKVTVHMSADARAWKKAKLRSHGVTVVEYEDDYGVAVEQGRKAAQSDPNCFFIDDENSR
TLFLGYAVAGQRLKAQFAQQGRVVDASHPLFVYLPCGVGGGPGGVAFGLKLAFGDNVHCF
FAEPTHSPCMLLGVYTGLHDAISVQDIGIDNLTAADGLAVGRASGFVGRAMERLLDGLYT
LDDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRICAAVAYQQRHGFSQTQLGNATHLVW
ATGGGMVPEDEMEQYLAKGR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacatacaaaagctcatcgcccggtatcctttggtcgaggatctggtcgccctc
aaagaaaccacctggtttaacccgggcgccacctctcttgcacaaggtctaccgtatgtc
ggcctgacggagcaggacgtaaacgccgcccatgaccgtctggcgcgctttgcgccgtat
ctggcgaaagcgtttccgcaaaccgctgccgctggcggcatgatcgaatctgacgtggtc
gctattccggccatgcaaaagcggctggaaaaagagtatgggcaaacgatcgacggtgaa
atgctgttaaaaaaagacagtcacctggcaatctctggttccattaaagcgcgcggcggc
atctacgaggtgctaacgcacgcggaaaaactggcgctggaggcgggtctgttaactacc
gacgatgactatagcgtgttgctttcgccggaatttaaacaattcttcagccagtacagt
atcgccgtcggttcaaccggcaatctggggctatcgatcggtatcatgagcgcctgcatc
ggttttaaagtgacggtacatatgtctgccgacgcccgcgcctggaaaaaagcgaagctg
cgtagccacggcgtgacggtcgtggaatacgaagatgattacggcgtggcggttgagcag
ggccgtaaagcagcgcaatccgatccaaactgtttctttatcgacgatgaaaactcccgc
acgctatttctgggctatgcggtagcgggtcagcgtctgaaagcgcaattcgcgcagcag
ggacgcgtcgttgacgccagtcacccactgtttgtttatctaccgtgcggcgttggcggc
ggccctggcggcgtcgcctttggcctgaaactggcgtttggcgacaacgtccactgtttc
tttgccgaaccgacccattcaccctgcatgttactcggcgtttataccggtctgcacgat
gccatctcagtacaagatatcggtattgataacctgacggcggctgacggcctggcggta
ggtcgcgcttcgggctttgttggtcgggcaatggagcgcctgcttgacggcctctatacc
ttagacgatcaaacaatgtacgacatgctgggctggctggcgcaggaggaaggaattcga
ctggagccatcagctctggcggggatggccgggccacagcgcatttgcgccgccgtcgcg
tatcagcaaaggcatggattcagtcagacgcagctcggcaacgcgacgcatctggtatgg
gcaaccgggggcggcatggtgccggaggatgaaatggaacaatacctggcgaaaggacgc
taa

DBGET integrated database retrieval system