KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_00060Help
Entry
A359_00060        CDS       T02199                                 

Definition
(GenBank) protein containing C-terminal region/beta chain of methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
sect00450  Selenocompound metabolism
sect00970  Aminoacyl-tRNA biosynthesis
sect01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sect00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A359_00060
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A359_00060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sect01007]
    A359_00060
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sect03016]
    A359_00060
Enzymes [BR:sect01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A359_00060
Amino acid related enzymes [BR:sect01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A359_00060
Transfer RNA biogenesis [BR:sect03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A359_00060
 Prokaryotic type
   Other AARSs
    A359_00060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AFP84415
UniProt: J3TWR0
Position
complement(13768..15810)
Genome map
AA seq 680 aa AA seqDB search
MTEVTKKILVTCALPYANGSIHLGHMLEHIQADIWVRYQRMRGQQVYFICADDTHGTPIM
LKAQQLGIEPEEMINNMHLKHRIDFAGFGISYDNYYSTHSEEHRQLSTLVYQRLKENGYI
KSRTISQLFDPEKAMFLPDRLVKGSCPKCHSPDQYGDNCEVCGATYDSLDLINPKSAVSC
ATPVMRESEHLFFDLPVFSKMLLTWIHSGALQEQVANKIQEWFESGLQQWNISRDAPYFG
FEIPDVPGKYFYVWLDAPIGYISAFKNLCQKRSNLCFDDFWSINSEADLYHFIGKDIVYF
HGLFWPAILEGSQLRKPTNLFVHGHLTINGAKMSKSRGTLIKASTYLKHLDPECLRYYYA
SKMSSRIDDIDLNLKDFFQRVNADIVNKVVNLAARNASFINKRFDSQLAATVANPALLAT
FVNASTSIGAAFSRRDMSCAIREIMSLADLANCYIHEQAPWAVAKQRHREEDLQAICSMG
LQLFRVLMTYLKPVLPSLAARAEAFLDLPLTWSALSTPLVSHRISPFKTLFSRIELAQVE
AVMEASRRKVTGMVAPATAPKESSQPVPPIADIIELNDFAKIDIRVALIKSAEHVQGSDK
LLKLMLNLGHSDCQVFSGIRDAYPDPKVLEGRLTIIVANLAPRKMRFGISEGMIMAAGLG
GKDIFLLNPDSGALPGMPVK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtaaccaaaaaaatattagtaacttgcgcattaccttatgctaacggttcc
attcatcttggccatatgcttgagcatatacaggcggatatctgggtccggtatcagaga
atgcgtggacagcaggtttattttatctgtgcggatgacacacacggcacaccaattatg
cttaaagcgcaacaattgggtattgaaccggaagagatgattaataatatgcatctgaag
catcggatagattttgcaggctttggcatcagttatgacaactactattctactcacagc
gaggaacatcggcaattatcgacgctagtttatcagcgcctaaaggaaaatggttacatc
aagtcacggaccatttcccaactttttgatcctgaaaaggccatgtttcttcccgaccgt
ttagtgaaaggaagctgtccaaaatgtcattcacccgatcagtacggcgataactgcgag
gtatgcggcgccacctacgactcactggatctcattaatccaaaatcggcagtgtcctgc
gctacgccagtcatgcgggaatcagaacacctgttcttcgatttacccgtttttagtaaa
atgctgctcacatggatacactctggcgcgctgcaagagcaggtagccaataagatacag
gaatggttcgaatcagggctacagcagtggaatatttcccgagacgcgccatattttggt
tttgagatcccggatgttccgggaaaatatttttatgtctggctggatgcgcctatcggc
tatattagcgcttttaaaaatctctgccaaaagcgtagcaacctttgctttgacgatttc
tggagcattaattccgaagctgatctttaccattttataggtaaggacattgtctacttt
catggccttttctggccggcaatactggagggcagtcagttacgaaaaccgactaatttg
tttgttcacggtcatctcactatcaacggcgccaagatgtccaaatctcgcggcactctg
atcaaggccagcacctatctgaagcacctggatccggagtgcctccgttattactatgct
tctaaaatgtcgtctcgcattgatgatatagacctaaatctaaaagatttttttcaacga
gtaaacgccgatattgtaaataaagtagttaacctggccgcacgtaacgccagctttatt
aataaacgttttgacagccagctagctgctactgtggccaatcctgcactgcttgcaacc
ttcgttaatgcctcgacatcaatcggcgcagcattcagcaggcgcgacatgagctgcgct
attcgcgaaatcatgtccctggcagatttagctaattgctacatccatgaacaagcaccc
tgggcggtggctaaacagaggcaccgtgaggaagatctgcaagccatctgttcgatggga
ttgcagcttttccgagtcctgatgacctatttaaaaccggttctaccatcgctcgcggcc
cgggcagaagcttttcttgacttacccctcacttggtcggccctttcaacaccgctagta
tcgcatcgcatcagcccctttaaaacgctattcagccggatcgaactggctcaggtagaa
gcggttatggaggcatcgcgccgaaaagtgacggggatggtggcgccagcaaccgcaccg
aaagagtcgtctcaacctgtgcccccaattgccgacatcattgagcttaatgattttgcc
aaaatagacatccgcgtagcgcttattaagtccgctgagcacgtgcaaggttcagataag
ctgctgaagctcatgctaaacttaggccattcagattgccaggtcttctccggaatccgg
gacgcctatccagaccctaaggtgctggaaggtcgtctgacgataatagtagctaatcta
gctccgcgtaagatgcgctttggcatatcagagggcatgataatggctgctggcctcgga
ggaaaagacatttttctacttaacccagattctggtgcgctcccaggcatgccggttaag
taa

DBGET integrated database retrieval system