KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_07590Help
Entry
A359_07590        CDS       T02199                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
sect00260  Glycine, serine and threonine metabolism
sect00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sect01100  Metabolic pathways
sect01110  Biosynthesis of secondary metabolites
sect01130  Biosynthesis of antibiotics
sect01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A359_07590
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A359_07590
Enzymes [BR:sect01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A359_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NanE His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFP85129
UniProt: J3Z4B3
Position
1130002..1130808
Genome map
AA seq 268 aa AA seqDB search
MERYQKLFSRLAARNEGAFVAFVTLGDPNPAYSLKIIDTLIDAGADALELGVPFSDPLAD
GAIIQNANLRAFASGVTRAHCFEMLASIRLKYPEIPIGLLIYANLVYSNGINAFYARCSG
VGVDSVLVADVPLQESLPFRHAALQHGVAPIFICPPNADDALVRKISLYSKGYTYLLARS
GVTGSEKRAKTPVVHLINALKEHQAAPTLQGFGISEPNQVRNACRAGVAGAISGSAIVRL
IENHVDNLEVMLEKLAHFVREMKIATLP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatcagaaattatttagccgattagcggcccgtaatgaaggtgcgttcgta
gcatttgtaacacttggagatcctaaccccgcgtactcgctaaaaatcattgatacactc
atcgatgctggtgctgatgcactagagctgggtgttcctttctcagatccactggcggat
ggagctatcattcaaaatgctaacctgcgtgcgtttgcctctggagttacccgggcgcac
tgttttgagatgctggcatcaattcgcttgaaataccccgagatccccattggcttactg
atctatgctaatttagtatacagcaatggtattaatgctttttacgctcgctgctctggc
gtcggtgtcgactctgtgttggtagcggatgtgccactacaagaaagcctgccgtttcgt
catgcagctttgcaacatggtgtagcgcctatttttatctgtcctcccaacgctgacgat
gctttagtgcgcaagatctctttgtatagcaaaggctatacctatctgctagcgcgttcc
ggtgttacaggaagcgaaaaacgagcgaagacaccagtagtgcacttaatcaatgctttg
aaggagcaccaagcagccccgacgctacagggatttggcatttctgagcccaaccaggtg
cgcaatgcttgccgcgccggggttgctggcgctatctccggctccgctatcgtacgtctt
atcgaaaaccatgtagataatttggaggtaatgctagaaaaattagcgcatttcgtacgg
gagatgaagattgctactctaccttga

DBGET integrated database retrieval system