KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_09060Help
Entry
A359_09060        CDS       T02199                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
sect00010  Glycolysis / Gluconeogenesis
sect00052  Galactose metabolism
sect00500  Starch and sucrose metabolism
sect00520  Amino sugar and nucleotide sugar metabolism
sect00521  Streptomycin biosynthesis
sect01100  Metabolic pathways
sect01110  Biosynthesis of secondary metabolites
sect01120  Microbial metabolism in diverse environments
sect01130  Biosynthesis of antibiotics
sect01200  Carbon metabolism
Module
sect_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sect_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A359_09060
   00052 Galactose metabolism
    A359_09060
   00500 Starch and sucrose metabolism
    A359_09060
   00520 Amino sugar and nucleotide sugar metabolism
    A359_09060
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A359_09060
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A359_09060
Enzymes [BR:sect01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A359_09060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AFP85272
UniProt: J3TG05
Position
complement(1344366..1345331)
Genome map
AA seq 321 aa AA seqDB search
MINYVLVGDVGGTNVRLALCYLSTGEISHIHTYASDGYDNLESVIHNYLISQQVAIKEAC
IAIACPINSDWVEMTNHSWAFSIKAMQANLELEQLEIINDFTAVAMATPMLTEKEVIQFG
GRHSIIGKPIAIYGAGTGLGVSHLLQVEKRWISLPGEGGHVDFAPNSEEEYSILNVLREE
LGHVSAERVLSGPGLVNLYRAIVKVDERLPENLLPKQVTKQALADSCIDSRRALSLFCVL
MGRFGGNLALNMGTFGGVYIAGGIVPRFLDFFRASGFRAAFEDKGRFKDYLLDIPVYLIR
HDQPGLLGAGAHIRQLMGYQL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgataaactatgtactagtcggtgatgttggaggtaccaacgtccggctagcgctgtgt
tatttaagtactggagagatttcccacatccatacctacgccagcgatggttacgacaac
ctggaaagcgtcattcataattatctaattagccaacaagttgctattaaagaagcctgc
attgctattgcctgtccgattaacagcgattgggttgaaatgaccaaccattcctgggcg
ttctccattaaagcgatgcaagctaacttagaattagagcaattagaaattattaatgac
ttcaccgcagtagcaatggccactcctatgctaacagaaaaagaagttattcagttcggt
ggccgtcactctattatcggaaagccaattgcaatttacggcgctggcacggggctaggt
gtaagccatcttctccaagtagagaagcgctggattagcctacctggagagggaggccat
gtagattttgcacctaacagtgaagaagagtacagcattctaaatgtgcttcgggaggaa
ttgggacatgtttctgcggagcgagtactgtcaggcccaggtttggtaaatttgtaccgc
gctattgtcaaggtcgacgaacgcttgcctgaaaatctattgccaaagcaggttactaaa
caagctctagccgacagctgcatcgacagccgacgtgctctgtcgctgttctgcgttcta
atgggccgcttcggcggcaacctcgcattaaatatgggaaccttcggtggtgtatatatt
gccggcggcattgtgccgcgatttttagatttcttccgcgcctccggtttccgcgcagct
tttgaagataaagggcgctttaaagattatcttctagatattcctgtgtacttaatccgt
catgatcagccaggattgctcggtgccggtgcccatatccggcagctaatgggctatcag
ctgtaa

DBGET integrated database retrieval system