KEGG   Secondary endosymbiont of Ctenarytaina eucalypti: A359_09660Help
Entry
A359_09660        CDS       T02199                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sect  Secondary endosymbiont of Ctenarytaina eucalypti
Pathway
sect00900  Terpenoid backbone biosynthesis
sect01100  Metabolic pathways
sect01110  Biosynthesis of secondary metabolites
sect01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sect00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A359_09660
Enzymes [BR:sect01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     A359_09660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFP85327
UniProt: J3TG39
Position
complement(1437724..1438920)
Genome map
AA seq 398 aa AA seqDB search
MRYLTILGSTGSIGVSTLAVVKENFDQFTVRALVAGTNVSLMTKQCLIFRPDYACMADAP
ASRALKDNLDAVRVDTTVLSGSQAACELAALDDVDTVMAAIIGVAGLSATLAALRAGKRV
LLANKESLVACGCLFMKEAHRHNALLLPVDSEHNAIFQSLPEPLQRTLGYASLREYGVSG
IILTGSGGPFRQTSLTELALMTPEQAYAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ARAEQIEVLLHPQSIIHSMVRYTDGSVLAQLGSPDMRTPIAHAMSYPKRMQSGAASLDFL
HIGPLSFEQPDVTRYPCLQLAVEASKCGQAATTTLNAANEIAVAAFLRGDIRFIDIAAVN
RRVLEQCSFSEPESLEAVLNIDDRAREMGRQSVRYYTQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcggtatttgacgattcttggaagcactggctctattggcgtaagtacgttggctgtc
gtaaaggaaaatttcgaccaattcacggtgcgcgcactagtggccggtaccaacgtctcc
ttaatgacaaaacagtgcctgatatttcgtcccgactacgcctgcatggccgatgcgcct
gcgtcgcgagcgctcaaggataacctcgatgcagtgcgtgttgacactacagtactgtca
ggatcacaggccgcttgtgagttggccgcgctcgatgatgtagatacggtcatggccgcg
attatcggcgtcgcaggcctatcggcaacgctggctgctctgcgcgcgggaaagagggta
ttgctggccaacaaagagtctttggtagcctgcgggtgtcttttcatgaaggaggcgcat
cgccataacgccttattgctgcccgttgatagcgaacataatgcgatttttcagagctta
cctgaaccacttcagcgtaccttaggttatgcctcactcagggagtatggcgtatctggt
attattttgacgggctctggaggaccatttcgccagacatcgttaaccgagctagcattg
atgacccctgagcaggcttatgctcatccaaactggtcgatgggacgtaaaatatcagta
gattcagctactatgatgaacaaaggattagaatacattgaagcgcgttggttatttaat
gctagggccgaacaaatagaagtactgttacatccgcagtctattatacattccatggta
cgctatactgacggcagtgtactagcgcaattgggatcgccagatatgcgtacgccaata
gcgcatgctatgtcctatcctaagcgcatgcaatccggcgccgcttcattggattttcta
catatcggtccgttgagcttcgagcagccagacgtcacccgttatccctgcctacagctg
gcagtggaagcaagtaagtgcggccaagcagcgaccactacgcttaatgccgccaatgaa
atcgcggtggcagcgtttttacggggcgatattcgctttattgatattgcagccgtaaat
agacgggttctagaacagtgcagtttctctgaacccgagagcctggaagcagtcctaaac
atcgatgaccgcgcgagggagatgggacgtcaaagcgtgcggtattatacacagtga

DBGET integrated database retrieval system