KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0093Help
Entry
SeD_A0093         CDS       T00757                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
KEGG Orthology (KO) [BR:sed00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SeD_A0093 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ACH75172
UniProt: B5FI33
Position
complement(97782..98159)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDENGDAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgcccagagtgtgtattcaggtgcaaagcgtctacattgaggcgcaatcc
tcacctgacgatgaacgttacgtttttgcctataccgtaaccatccgcaatctgggccgg
gcgccagtgcagctattgggccgctactggctgattaccaatggtcatggccgtgaaacc
gaagtccagggcgaaggtgtggttggcgtccagccgcgcattgcgcctggcgaagagtat
cagtacaccagcggcgcggtaattgaaacgccgctgggcaccatgcagggtcattacgaa
atgatcgatgaaaatggcgacgcctttaccatcgacattcccgtgtttcgactcgccgtc
cctacactcattcactaa

DBGET integrated database retrieval system