KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0300
Entry
SeD_A0300         CDS       T00757                                 

Definition
(GenBank) hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sed00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeD_A0300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sed02044]
    SeD_A0300
Secretion system [BR:sed02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeD_A0300
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACH75927
UniProt: A0A6C6ZZ84
Position
317961..318446
AA seq 161 aa
MAYDIFLKIDGIDGESMDDKHKNEIEVLGWRWNIHQESTMHAGSGLGSGKVSVTNLEFEH
YIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGNREGEIA
SRERIELSFSIVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcttatgacatttttttgaaaattgacggcattgacggcgagtcaatggatgacaaa
cacaaaaatgaaattgaagtactgggctggcgctggaatattcatcaggaatccaccatg
cacgccggtagtggcctcggctccggtaaggtctctgtcactaatctggaattcgagcat
tatatcgatcgcgccagcccgaatctgttcaaatactgtgcctccggtaagcacattccg
caggccattctggttatgcgtaaggctggcggcaacccgttggagtacctcaagtacacc
tttaccgatctgatcgttgcggtcgtttcacctagcggtaacagagaaggcgaaatcgcg
tctcgcgagcggattgagctctccttcagcatcgtgaagcaggaatacgtggtgcagaac
cagcagggtggcagcggcggcaccatcaccgcaggctacgacttcaaggccaacaaagaa
atttaa

DBGET integrated database retrieval system