KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0306Help
Entry
SeD_A0306         CDS       T00757                                 

Definition
(GenBank) SciS protein
  KO
K11891  type VI secretion system protein ImpL
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sed00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeD_A0306
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sed02044]
    SeD_A0306
Secretion system [BR:sed02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeD_A0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: ACH74311
Position
323143..327012
Genome map
AA seq 1289 aa AA seqDB search
MQKFLSLLFSRRALAVVGVLVLALLVWFVGPLVSFDTLRPLASVGSRVVTIALLLMLLVL
WLVNWSMSIIGISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLIGFILLMYALYGLYRLW
RALRMDEQLLRRFLHPRGEEVPVAGEIKADLRTVNHIVTQAIRQLRQLRVDMPGWRKIFE
GKRFLYELPWFMVVGSPGDGKTTALLNTGLQFPLAEQMEQTSRILTVPGGGTLHCDWWFT
NEAVLIDTAGRYARHDDGGEVSAAQRNAGEWQGFLGLLRKHRPGAPLNGVILTLNVADLT
AQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDLLPGFSEYFRTLTSHLRAQIW
GFTLPYSRRRKAGDPQALHAACAQELARLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREF
AALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIR
TARGESSASLPHALPDGNRSYFLHDLLTQFIFREAHLVEPNLQWAWRYRLLRLGGHLLVL
VLAFLLWQGMQTSQQTNGDYLNEISARATRLDGEVKAYTGKPAMAPVPALLDSARELSAW
PELDPDAPPLTWRYGLYSVPPVTDSVASLYNRLLDQLLLPPLVKRMEYVLADAIARQDSK
AAYDALRIYLLLNLDKDHEDKYNAAEIQSWVVNDLGNSDSVAGFGGRAAVLTHIEALFDG
SRVVHSPYEKNEALIRQARAFLDGHTSTERIYARALAAMESEAPQEFTLVRAVGADAGTV
FVRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRS
QIPGQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPD
SPLMRLGKAVVEQTTLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTL
VDDRFAALREVIAGRTDGGQSGGGTMQIASLLTMLNEYYTQLTIADSALAAGTLPARITA
ADKLQLEAAKLPAPLKNILLDLTKQGTRKINAGTGDVLNTQMEAMMGDDCRDAIDGRYPF
ADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDPWRYKPTEGNMTLQGPDLTPF
QQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAHGPDRPLKVTW
PGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRR
VVLEITAGRDFNPVSRELLQNFSCPARAL
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatttcttagtctgcttttttcccggcgcgcgctggcagttgtgggcgttctg
gttctggcgctgctggtctggtttgtcgggccgctggtgtcatttgataccctgcgcccg
ctggcctccgtgggtagccgggtagtgaccattgccctgttgctgatgctgctggtactg
tggctggtcaactggtcgatgagtatcatcggcatcagtgtcctgtgcctggcgattggc
ttcgtcacaccgctgctggccctgggcgatgtccatccgtttgcgccgctgtgggtccgc
ctgacattaattggtttcatcctgctgatgtacgcgctgtacggcctgtaccggctgtgg
cgtgcgctgcgtatggatgaacaactgctgcgtcgcttcctgcatccgcgcggggaagag
gtaccggtggcaggcgagatcaaagccgacctgcgcaccgtcaaccatattgtcacgcag
gccatccggcagctgcggcagttgcgggtggatatgcctggctggcgtaagatcttcgag
ggaaaacgctttctgtatgagctgccgtggttcatggtggtcggcagtcccggcgacggc
aaaaccacggccctgctgaacaccggattgcagttcccgctggcggagcaaatggagcag
acttcgcgcatcctgacagtaccgggtggcggcacgctacactgcgactggtggtttacc
aacgaagcggtgttgattgataccgccggacgctacgcccgccacgatgacggcggagaa
gtgagcgccgcgcagcgtaacgccggagagtggcagggctttctcggtctgctgcgtaaa
catcgccccggcgcgccgcttaacggcgtgatcctgacgctaaacgtggcggatttaacc
gcacagtcaccggcggaacgcctggcggcctgcgccgctctgcgggcgcgactggcagaa
ctgcgcgagaccctggggattcgctttccggtctatctggtggtcaccaaaatggatttg
ttgccggggttcagcgagtattttcgcacgctgaccagccatcttcgcgcacaaatctgg
ggctttacgttgccgtacagccgcaggcgaaaagcgggcgacccgcaggcgctgcacgcc
gcctgcgcgcaggagctggcgcgcctgacgctgcggctggatcagggactggatacccgg
ttacaggaagagtacgaccttaaaagccgccagcggctgtataccttcccgcgtgagttc
gccgccctcggcgagccgttgctggaggctattgaacagatcttcctcgattcaaaattc
gatgccacgcaactgaataacacgctgcgcggggtgtttttcaccagcgccgcgcaggcg
caggccgacgccgtggccgaccagttgagtatctggcagcgctttgtccgggcgataaga
accgcccgtggcgaatcatccgcctctctcccgcacgctctgccggacggcaaccgcagc
tactttctgcatgacctgctgacacagtttattttccgtgaagcgcacctggtggagcca
aacctccagtgggcctggcgttaccgcctgctgcgcctcggcgggcacctgctggtactg
gtgctggcattcctgttgtggcaggggatgcagaccagccagcagaccaacggcgactat
ctgaatgaaatcagcgcccgcgcgacccggctggacggtgaagtgaaagcctacaccggt
aaaccggcgatggctcccgtcccggcactgctggatagcgcaagggaactgtccgcctgg
ccggaactggacccggacgcgccgccgctgacctggcgctacggcctgtacagcgtaccg
ccggtaaccgacagcgtggcgtcgctgtacaaccgtctgctggatcaactgctgctgccg
ccgctggtgaaacggatggagtatgtgctggcggacgccattgcccgtcaggacagtaaa
gctgcgtatgatgccctgcgcatctatctgctactgaatctggataaagatcacgaagat
aaatacaacgcggcggagatccagtcgtgggtggttaacgatctggggaacagcgacagc
gtggccgggttcggcgggcgcgccgccgtgctgacgcatatcgaagcgctgtttgacggc
agccgggtggtgcattcaccgtatgagaaaaatgaggcactgatccgccaggcgcgggca
ttcctcgacggtcacaccagtaccgagcgtatctatgcgcgggcgctggcggcgatggag
agcgaagcgccgcaggagttcacgctggtacgcgccgtcggcgcggatgcgggaacggtg
tttgtgcgtagcaacggcgcgccgctggatcggggcgtgccgggtatttttacccgtgaa
ggataccgggagctgttcgacaaacgattaccggaatttgtggcggcggcgacggcgaac
gatggctgggtgatgggccgggagagtacgccaaaaaagctgactgacagcctgcgcagc
cagataccggggcaggagcagtctgtcgcccgcgaagtccgccgtttgtacctgacggaa
tatgcccgccgctggcaggattttctggacagtatccatagtatcaacagtgccggggaa
gagggcagttccggcctggcctatgatttacaggtgctgcgcaccctggcgtcgccggac
tcaccgctgatgcggctgggaaaagcggtggtggagcagaccacgctggtgccgccgccg
gacccgcaggccagacagaaacaactggcgcagcgcgcatccggtaacgcggggaaagtg
gtacagacggcaaaactgttccaggatattcacccggaagaacggctggaaaaaacgctg
gtggatgatcgtttcgccgcgctgcgcgaggtcattgccgggcggacggacggcggacag
agcggcggtgggacgatgcagatcgcttcgctgctgaccatgctcaacgagtattacacc
caactgaccattgctgatagcgcgctggcggcggggacgttgccagcgcgcattactgcc
gcagacaagttgcaactggaggcggcgaaactgcctgcgccgctgaaaaacatcctgctg
gatctgacgaagcagggaacgcgcaaaatcaacgccgggaccggcgacgtgctgaacacc
cagatggaggcgatgatgggcgacgactgccgtgacgccatcgacgggcgttatccgttc
gccgacagcccgcaggaggtcagcgccgaggactttaaccgcatcttcgccagcggcggc
gtactggatgctttctggagcaaacaactggctccgctggcggacaccgccagcgacccg
tggcgctacaaaccgaccgaaggcaacatgacattgcaggggccggatttaacgccgttt
cagcaggcgaagcagatccgcagcgtgttttttaacagcgagggcgggaaaaaattttcc
tggtcgatgcagattagcgtggtggatatggacccggccatcacggaactggtgattgat
atcgacggccaggtgctgcgctacgcccatggtccggaccggcccctgaaagtgacgtgg
ccgggaccgcgcaacggctcgatggcggaaatcaccgccagcccgcgtattcgccaggac
acctcaacgctactgaccggcgggccgtgggcgctgtttcatctgctggacgccggaatg
gtacaggaaacggcggtgcgggggcgccaattggtggaatatgattttgacggtcgccgg
gtggtgctggaaatcactgccgggcgggattttaacccggtcagccgggagctgttgcag
aacttcagttgcccggcgagggcgctgtaa

DBGET integrated database retrieval system