KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0310
Entry
SeD_A0310         CDS       T00757                                 

Definition
(GenBank) Rhs-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sed00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeD_A0310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sed02044]
    SeD_A0310
Secretion system [BR:sed02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeD_A0310
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: ACH75400
UniProt: A0A6C6ZXP1
Position
329155..331344
AA seq 729 aa
MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAESAVEQAAGSLFGALPEP
SGLVKAAVAAAQAAAAAGMAQDAVSAIVSAVADGPGAHNVTVSGSAVPPGALLFASLDGG
ETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTA
ARVVGHEGRSVTYELRMEPWLKLLTHTSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVES
YPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLVLADAISAHKACPDSPLVEW
HQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRETGHATYEHYEW
PGDYFDKSEGEMLTRIRMEAQRSPGSRVLGAGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPSGQE
IWTDQYGRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGD
PDLPIIVGRTYNQDTMPPWGLPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHA
EKDLNTTVKNNETHTVMVDRTKTIIKNETNSIGEDRNTTVTKNDGLSVKLAQTINIGTTY
RLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVMQLIGKGIDMNPDGGTAVTAD
DIAPLPTSE
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgagttttgtatccacaaataataaatccggtatgggagggctgacgacaaccacgccg
ccgataaccggagaaagtggcggtgtcaccgcagattcagtcgccggaagcgtggcagat
gcggcggaatccgccgtggaacaggctgcgggatcgctgtttggcgcattgccggagcca
tcaggactggtgaaagccgcggtagcagcggcgcaggctgccgccgccgcaggtatggcg
caggatgcggtatcggccatcgtctctgctgttgcagacgggccgggggcgcataatgtg
acggtcagcggcagcgccgtaccgccgggcgcattactgttcgccagcctggacggcggc
gaaacattaagtgaactgttcagctatgtggtacagctaaaaacgcccgacaccctgaat
ctgggctatgtctccccggcggccaacctgccgctcaaaccgatggtgggcaaagatctg
tgcgtcaacatcgaactggatggtggcggtaaacgacatatcagcgggctggtcacggcg
gcgcgggtggtgggccatgaagggcgttcggttacctatgagctgcgtatggagccgtgg
ctgaaactgctgacccataccagcgactacaaagcattccagaataaaaccgtggtggat
attctggatgaggttctggcggaatacccctacccggtggaaaagcggctggtggaaagc
tacccggtacgcacctggcaggtgcagtacggtgaaactgattttgattttcttcagcga
ctgatgcaggagtggggcatctactggtggtttgagcacagcgaggacagccacacgctg
gtgctggcggatgccatcagcgcccacaaagcatgtccggactcgccgctggtcgagtgg
caccaggaagggctgaagctggacaaggagtttatccacactatcacggcaaacgagagt
ctgcggactggccagtgggtgctggatgatttcgattttacgaagccacgttcattgctg
gcaaacacggtggcaaacccgcgtgaaaccggtcatgccacctacgagcattatgagtgg
ccgggagactacttcgacaagagtgaaggcgagatgctgacgcgcattcgtatggaagcg
cagcgcagccccggcagccgggtgctgggtgccgggaatattcgtacgctgatgacaggc
tataccttcacgctggaaaactatcccaccgccgaagtcaatcaggaatatctgctgatg
cagaccttgctgtttgtgcaggacaacgcgcagcacagcgggcaggaccagcactttacc
ttttccacccgttttgaactgcaccccacccgcgaggtgttccgcccgcagcggacggtg
agcaaaccccacaccaaagggccgcagagcgccattgtcaccggcccgtcgggccaggaa
atctggacggatcagtacgggcgggtaaaggtacagtttggctgggatcgctacggcaaa
atggatgaaaacagctcctgctggatacgcgtcagctacccatgggcgggcaaaggcttc
gggatgatccagatcccgcgtatcggccaggaagtgctggtggatttcaaaaacggcgat
ccggatctgccgatcatcgtggggcgtacctacaaccaggacaccatgccgccgtgggga
ctgccgggaatggcgtcgcagagcgggatcttcagccactcgctgtatggcgggccaacg
aacggcaacatgctgcgttttgacgacaaaacgggcgcggaggaagtgaagttccacgcg
gaaaaagatctcaacaccacggtgaagaataatgaaacgcatacggttatggtggatcgc
actaaaaccattattaaaaatgaaaccaacagtattggtgaggacagaaacaccacggta
acgaagaatgacggcctttccgtaaaactggcgcagacgatcaatatcggcaccacttat
cgtttagatgttggcgatcaattcacacttcgctgcggcaatgcggcgcttgttttacat
aaggacggctccattgagttttgtggcaagcaactgatgttacataccagcgatgtcatg
caactgattggtaaaggtattgatatgaacccggatggcggcacagccgtaaccgccgat
gatattgccccccttcccacctctgagtga

DBGET integrated database retrieval system