KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0823Help
Entry
SeD_A0823         CDS       T00757                                 

Definition
(GenBank) endonuclease VIII
  KO
K05522  endonuclease VIII [EC:3.2.2.- 4.2.99.18]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sed00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SeD_A0823
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sed03400]
    SeD_A0823
Enzymes [BR:sed01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     SeD_A0823
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SeD_A0823
DNA repair and recombination proteins [BR:sed03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SeD_A0823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS DUF4351 Zn-ribbon_8 Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: ACH75911
UniProt: B5FNF0
Position
818856..819647
Genome map
AA seq 263 aa AA seqDB search
MPEGPEIRRAADNLEAAIKGKPLTDVWFAFAQLKPYESQLTGQLVTRIETRGKALLTHFS
NGLTLYSHNQLYGVWRVIDTGEIPQTTRILRVRLQTADKTILLYSASDIEMLTAEQLTTH
PFLQRVGPDVLDARLTPEEVKVRLLSPRFRNRQFSGLLLDQAFLAGLGNYLRVEILWQVG
LTGQHKAKDLNEAQLNALSHALLDIPRLSYTTRGQSDENKHHGALFRFKVFHRDGEACER
CGGIIEKTTLSSRPFYWCPHCQK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaggcccggaaattcgtcgtgcggcggataatctggaggcggcaatcaaaggc
aaacccttaaccgatgtctggtttgcctttgcacagttaaaaccgtatgaatcgcagctt
accggtcaacttgttacccggatagagacgcggggaaaagcgttattgacccacttttca
aatggcctgacgctctacagccacaaccaactctatggcgtatggcgggtgatcgatact
ggtgaaataccgcagaccacgcgtatattgcgcgtcaggctacaaacggcggataaaact
attctgctttatagcgcgtctgatatcgaaatgctgacagcagagcagctcacgacgcac
ccttttttacagcgggtcggtccggatgtgctggacgcgcgtctcactccggaagaggtt
aaagttcgattgctgtcgccgcgttttcgcaaccgacaattttctgggctgttgctggat
caggcctttctggcgggattggggaattatctgcgcgttgaaatcctctggcaggtaggg
ttaaccggacagcataaagcgaaagatctcaacgaggcgcaactgaatgcgctttctcac
gcgctgttggatattccgcgcctgtcctacacgactcgcggtcagtcggatgaaaacaag
catcatggcgcactgtttcgctttaaggttttccatcgtgacggcgaagcgtgcgagcgg
tgcggcggcattattgaaaagacaacactgtcctcacgcccgttttactggtgcccgcat
tgccagaaatag

DBGET integrated database retrieval system