KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0824Help
Entry
SeD_A0824         CDS       T00757                                 

Definition
(GenBank) protein AbrB
  KO
K07120  uncharacterized protein
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Brite
KEGG Orthology (KO) [BR:sed00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SeD_A0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AbrB
Motif
Other DBs
NCBI-ProteinID: ACH76493
Position
complement(819702..820748)
Genome map
AA seq 348 aa AA seqDB search
MPILQWFLLFLLSLLISLIFLWLHLPAAMLLGPMIAGIVLSLRGSTLQLPRGIFLAAQAI
LGCMIAQNLTGSILTTLALYWPVVLLVLLVTLLSSAIVGWLLVRYSSLPGNTGAWGSSPG
GAAAMVAMAQDYGADIRLVAFMQYLRVLFVAGAAVLVTRLILGDSAAAVSQQVIWFPPLS
GNLLTTLLLAIVAGIAGRLLRIPSGTMLLPMLAGAILHSQGIIEIELPEWLLAVAYMAIG
WRIGLGFDRQVFFMALRPLPQILLSIFALMAICAAMAWGMAYYMQIDFMTAYLATSPGGL
DTVAAIAAGSSADMALIMAMQTLRLFSILLTGPAVARFISTYAPRQPL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccgattctgcagtggtttttgttgttcctgttatcgctgctcatttcccttattttt
ctctggctgcaccttccggcggcgatgctgctcggtccaatgattgcgggtatcgtgttg
agtttgcgaggtagtacgctacaacttccgcgcggtatttttctcgccgcgcaggcgatt
ctcggctgtatgatcgcccaaaatctaaccggttcgatattgaccaccctcgccctctac
tggccggtcgtgcttttagtgttgctggtgacgctgctttccagcgcgatagtcggctgg
ctgctggtacgctacagctcgctgcccggcaacaccggcgcatgggggtcttcgccgggc
ggcgcggcggcaatggtagcgatggcgcaagattacggggcggatatccgcctggtggcg
tttatgcagtatctacgggtactgtttgtggctggcgcggcggtgctggtgacacgcctg
atactcggcgacagcgcggcagcggtcagccaacaggtgatctggtttccaccgcttagc
ggtaatttattgacgacgctgctattagcgatcgtggcgggcattgccggtcgcctgttg
cgtatcccttccggcacgatgctgctccccatgttggcaggcgcgattctccattcgcaa
ggcatcattgaaattgaattacccgaatggctgctggccgtggcgtatatggcgataggc
tggcgtattgggctgggttttgacagacaggtgttttttatggcgctgcggccattgccg
caaatcttattgtcaattttcgcgctgatggcgatttgcgccgcgatggcgtggggaatg
gcttactacatgcagattgattttatgacggcttatctcgccaccagtcccggtggtctg
gatacggttgccgcgatcgcggcaggaagcagtgccgatatggcgctcatcatggcaatg
caaaccctacggctgttcagcattctgttaactgggccagcagtggcccgttttatatca
acctatgcgcccagacaacctttgtag

DBGET integrated database retrieval system