KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0825Help
Entry
SeD_A0825         CDS       T00757                                 

Gene name
gltA
Definition
(GenBank) citrate (Si)-synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00020  Citrate cycle (TCA cycle)
sed00630  Glyoxylate and dicarboxylate metabolism
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01130  Biosynthesis of antibiotics
sed01200  Carbon metabolism
sed01210  2-Oxocarboxylic acid metabolism
sed01230  Biosynthesis of amino acids
Module
sed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sed_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sed_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sed00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SeD_A0825 (gltA)
   00630 Glyoxylate and dicarboxylate metabolism
    SeD_A0825 (gltA)
Enzymes [BR:sed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     SeD_A0825 (gltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-ProteinID: ACH75188
Position
complement(820885..822168)
Genome map
AA seq 427 aa AA seqDB search
MADTKAKITLTGDTAIELDVLKGTLGQDVIDIRSLGSKGVFTFDPGFTSTASCESKITFI
DGDEGILLHRGFPIDQLATDSNYLEVCYILLYGEKPTQEEYDEFRTTVTRHTMIHEQITR
LFHAFRRDSHPMAVMCGITGALAAFYHDSLDVNNPRHREIAAFRLLSKMPTMAAMCYKYS
IGQPFVYPRNDLSYAGNFLNMMFSTPCETYEVNPVLERAMDRILILHADHEQNASTSTVR
TAGSSGANPFACIAAGIASLWGPAHGGANEAALKMLEEISSVKHIPEFVRRAKDKNDSFR
LMGFGHRVYKNYDPRATVMRETCHEVLKELGTKDDLLEVAMELEHIALNDPYFIEKKLYP
NVDFYSGIILKAMGIPSSMFTVIFAMARTVGWIAHWNEMHTDGMKIARPRQLYTGYDKRD
FKSALKR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctgatacaaaggcaaaaatcacccttactggtgacactgctattgaactggatgtg
ctaaaaggtacactcggtcaagatgttattgatattcgtagtctcggttcaaaaggagtt
tttacttttgaccctggtttcacctctaccgcatcctgcgaatctaaaatcaccttcatc
gacggcgacgaaggcattttgttgcatcgcggtttcccgattgaccagcttgctaccgat
tccaactatctggaagtctgttacatcctgctgtacggcgaaaaaccgacgcaggaagag
tatgacgagttcagaacgacagtcacccgccatacgatgatccatgagcaaatcactcgc
ctgttccatgctttccgtcgcgactcacatccgatggcggtaatgtgcgggatcactggc
gcgctggcggcgttctaccacgactcgctggatgtgaacaatccgcgccaccgtgaaatc
gcggcgttccgcctgctgtccaaaatgccgaccatggcggcgatgtgttacaaatattcc
atcggtcagccgtttgtttatccgcgcaacgacctttcctacgccggtaacttcctgaac
atgatgttctccacgccgtgtgaaacctatgaagtgaatccggtactggagcgcgcgatg
gaccgtattctgatcctgcacgctgaccatgagcagaacgcctcaacgtcaacggtacgt
accgcaggttcaagcggcgccaacccattcgcctgcattgccgccgggatcgcctccctg
tggggacccgcgcacggcggcgccaacgaagccgcgctgaaaatgctggaagaaatcagc
tctgttaaacacattccggaatttgttcgccgtgcgaaagacaagaatgattctttccgc
ctgatgggcttcggtcaccgtgtttacaaaaactacgatccgcgcgccaccgtgatgcgt
gaaacctgccatgaagtgctgaaagagctgggcaccaaagatgatctgctggaagtggcg
atggagcttgagcacattgcgctcaacgacccgtacttcatcgagaagaaactgtacccg
aacgtagacttctactccggcatcattctgaaagcgatgggcattccgtcctccatgttc
accgtgatcttcgccatggcgcgtaccgttggctggattgcacactggaatgaaatgcac
actgacggcatgaaaatcgcccgtcctcgtcagctgtataccggctacgataaacgcgat
tttaaatcggcgctgaagcgttaa

DBGET integrated database retrieval system