KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0826Help
Entry
SeD_A0826         CDS       T00757                                 

Gene name
sdhC
Definition
(GenBank) succinate dehydrogenase, cytochrome b556 subunit
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00020  Citrate cycle (TCA cycle)
sed00190  Oxidative phosphorylation
sed00650  Butanoate metabolism
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01130  Biosynthesis of antibiotics
sed01200  Carbon metabolism
Module
sed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sed_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sed_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SeD_A0826 (sdhC)
   00650 Butanoate metabolism
    SeD_A0826 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SeD_A0826 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ACH75818
Position
822908..823312
Genome map
AA seq 134 aa AA seqDB search
MWALFMIRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFIAVGILLWLLGTSLSSP
EGFQQAADIMDGFIVKFIMWGILTALAYHVIVGIRHMLMDFGYLEETFEAGQRSAKISFV
ITVVLSLLAGVLVW
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgttattcatgataagaaatgtgaaaaaacaaagacctgtcaatctggatcta
caaacgattcggttccccatcacagcgatagcgtccattctccatcgcgtatccggtgtg
attactttcatcgccgtcggcatactactgtggctactgggcaccagcctctcttctccg
gaaggattccagcaggccgccgatatcatggacggcttcatcgttaaatttatcatgtgg
ggcatccttaccgcgctggcgtatcacgtcatcgtgggaattcgtcacatgttaatggat
tttggctatctggaagaaacattcgaagcgggtcaacgctctgccaaaatctcttttgtt
atcactgtcgtgctttcacttctcgcaggagtcctcgtatggtaa

DBGET integrated database retrieval system