KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0829Help
Entry
SeD_A0829         CDS       T00757                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00020  Citrate cycle (TCA cycle)
sed00190  Oxidative phosphorylation
sed00650  Butanoate metabolism
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01130  Biosynthesis of antibiotics
sed01200  Carbon metabolism
Module
sed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sed_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sed_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SeD_A0829
   00650 Butanoate metabolism
    SeD_A0829
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SeD_A0829
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SeD_A0829
    1.3.5.4  fumarate reductase (quinol)
     SeD_A0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: ACH77024
Position
825433..826152
Genome map
AA seq 239 aa AA seqDB search
MMKLEFSIYRYNPDVDNAPRMQDYTLEGEEGRDMMLLDALIQLKEKDPSLSFRRSCREGV
CGSDGLNMNGKNGLACITPISALTQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKP
YLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAY
RFLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactcgaattttcgatttatcgttataacccggatgtcgataacgctccgcgt
atgcaggattacaccctggaaggcgaagaagggcgcgacatgatgctgctggatgcgtta
atccagcttaaagaaaaagatcccagcctttctttccgccgttcctgccgcgaaggtgtg
tgcggttctgatggtttgaatatgaacggtaagaatggtctggcctgtattacccctatt
tcggcgctgactcagccgggtaagaagattgtgattcgcccgctgcccggtttgccggtg
atccgcgatttggtggtagacatggggcaattctacgcacaatatgagaagattaagcct
tacttattgaataatgggcaaaatccaccggctcgtgagcatctgcagatgccggagcag
cgtgaaaaactcgatgggctgtatgaatgtattctttgcgcctgttgctcaacatcctgc
ccgtcattctggtggaacccggataagtttatcggtccggcggggctgctcgcggcgtat
cgattcctgatcgatagtcgtgataccgagaccgacagtcgtctggaagggatgagcgat
gcattcagcgtattccgctgtcacagcattatgaactgcgtcagtgtatgtcctaaggga
ctgaacccgacgcgcgctatcggccatattaagtcgatgctgttgcagcgtagcgcataa

DBGET integrated database retrieval system