KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0830Help
Entry
SeD_A0830         CDS       T00757                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00020  Citrate cycle (TCA cycle)
sed00310  Lysine degradation
sed00380  Tryptophan metabolism
sed01100  Metabolic pathways
sed01110  Biosynthesis of secondary metabolites
sed01120  Microbial metabolism in diverse environments
sed01130  Biosynthesis of antibiotics
sed01200  Carbon metabolism
Module
sed_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sed_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sed00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SeD_A0830 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    SeD_A0830 (sucA)
   00380 Tryptophan metabolism
    SeD_A0830 (sucA)
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SeD_A0830 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: ACH77976
Position
826678..829479
Genome map
AA seq 933 aa AA seqDB search
MQNSALKAWLDSSYLSGSNQSWIEQLYEDFLTDPDSVDANWRLTFQQLPGTGVKPDQLHS
KTREYFRRQALAGSRHSSTISDPDTNVKQVKVLQLINAYRFRGHQHANLDPLGLWKQERV
ADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELLDALKQTYCGPIGAEYMHITSTEE
KRWIQQRIESGRAAFSADEKKRFLNELTAAEGLERYLGAKFPGAKRFSLEGGDALIPMLK
EMVRHAGNSGTREVVLGMAHRGRLNVLINVLGKKPQDLFDEFAGKHKEHLGTGDVKYHMG
FSSDIETEGGLVHLALAFNPSHLEIVSPVVMGSVRARLDRLDEPSSNKVLPITIHGDAAV
TGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSNPLDARSTPYCTDIGKMVQAPIF
HVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRHGHNEADEPSATQPLMYQKIKKH
PTPRKIYADKLEADKVATLEDATEMVNLYRDALDAGECVVKEWRPMNMHSFTWSPYLNHE
WDEAYPNKVEMKRLQELAKRISTVPEAIEMQSRVAKIYGDRQAMAAGEKLFDWGGAENLA
YATLVDEGIPVRLSGEDSGRGTFFHRHAVIHNQTNGSTYTPLQHIHSGQGQFKVWDSVLS
EEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLLPH
GYEGQGPEHSSARLERYLQLCAEQNMQVCVPSTPAQVYHMLRRQALRGMRRPLVVMSPKS
LLRHPLAVSTLDELANGSFQPAIGEIDELDPKAVKRVVMCSGKVYYDLLEQRRKNDQKDV
AIVRIEQLYPFPHKAVQEALQPYAHVHDFVWCQEEPLNQGAWYCSQHHFREVIPFGAALR
YAGRPASASPAVGYMSVHQKQQQDLVNDALNVD
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacagcgctttgaaagcctggttggactcttcttacctctctggttcgaatcag
agctggatagaacagctctatgaagacttcttaaccgatcctgactcggtagacgctaac
tggcgtttgacgttccagcagttacctggtaccggagtcaaaccggatcaactccattca
aaaacacgtgaatatttccggcggcaggcgttggctggctcacgtcactcttctacgatt
tccgaccctgacaccaatgtgaagcaggttaaagtcctgcagcttatcaacgcttatcgt
ttccgtggccatcagcatgcaaacctcgatccgctgggactgtggaaacaagaacgcgtg
gcggatctggacccttctttccatgatttgaccgaggccgatttccaggaaaccttcaat
gtcggctcctttgccagcggcaaagagacgatgaagctgggcgagctgctcgacgcgctc
aaacagacctactgcggcccgattggcgctgagtatatgcacatcaccagcaccgaagag
aaacgctggatccaacagcgcatcgaatccggtcgtgcggcctttagcgctgacgagaaa
aaacgtttcctgaacgaactgaccgccgctgaagggctggaacgttatctgggtgccaaa
ttcccgggtgcgaaacgtttctcgcttgaggggggagatgcgctgatacccatgctgaaa
gagatggttcgccatgcgggtaacagcggaactcgcgaagtggtgctggggatggcgcac
cgcggtcgcctgaacgtgctgatcaacgtactgggtaaaaaaccgcaggatctgttcgac
gagtttgccggtaaacataaagaacatctgggtaccggcgacgtgaagtatcacatgggc
ttctcgtcagatatcgaaaccgaaggcggtctggttcacctggcgctggcgtttaaccca
tcgcacctggaaattgtgagcccggtggtgatgggctccgtgcgtgcccgtctggaccga
ctggacgaaccgagcagcaacaaagtgttgccgatcactattcacggcgacgccgcggtg
accggccagggcgtggttcaggaaaccctgaacatgtcgaaagcgcgcggttacgaagtg
ggcggtacggtacgtatcgttatcaacaaccaggtgggcttcaccacctctaacccactg
gatgcgcgttcaacgccttactgcaccgatatcggtaaaatggtccaggcgccgattttc
cacgtcaatgcggacgatccggaagccgtcgcttttgtgacccgtctggcgctggacttc
cgtaacacctttaaacgcgatgtgttcatcgatctggtgtgctaccgccgtcacggccac
aacgaagccgacgagccaagcgcaacccagccgctgatgtaccagaaaattaaaaagcat
ccgacgccgcgtaaaatctacgccgacaagctggaagcggacaaagtcgcgacgctggaa
gatgccaccgaaatggttaacctctatcgcgatgcgctggatgcaggcgaatgcgtggtg
aaagagtggcgtccgatgaatatgcactcgttcacctggtcgccgtatctaaaccacgaa
tgggatgaagcatacccgaacaaggtagaaatgaagcgtctgcaggagctggcaaaacgt
atcagcactgtgccggaagccattgaaatgcagtctcgcgtggcgaaaatttatggcgac
cgtcaggcaatggcggcaggcgagaaattgtttgactggggcggcgcggaaaatctggct
tacgccacgctggtcgatgaaggcattccggtgcgcctgtccggggaagactccggtcgc
ggcaccttcttccatcgtcatgcggtgatccacaaccagacgaacggctcaacgtatacg
ccgttgcagcatattcacagcggtcagggacagtttaaagtctgggactccgtgctgtct
gaagaagcggtactggcttttgaatacggttatgccacggcggaaccacgtaccctgact
atctgggaagcgcagtttggcgattttgccaacggcgcgcaggtagtgattgaccagttc
atctcctccggcgagcagaaatggggccggatgtgcggtctggtgatgctgttgccgcac
ggctatgaagggcaggggccggagcactcttccgcgcgtctggaacgttatctgcaactt
tgcgccgagcagaatatgcaggtttgcgtgccgtccaccccggcgcaggtctaccatatg
ctgcgccgtcaggcgctgcgcgggatgcgtcgtccgctggtggtgatgtcgccgaaatcg
ctgctgcgtcacccgctggcggtttccacgcttgatgaactggcgaacggttccttccag
ccggccattggcgaaattgacgagctggaccctaaagccgtaaaacgcgtggtaatgtgt
tctggtaaggtttattacgacctgctggaacaacgtcgcaaaaacgaccagaaagatgtc
gctatcgtgcgcatcgaacagctctatccgttcccgcataaagcggtgcaggaagcgctg
caaccatacgctcacgtccatgattttgtctggtgccaggaagagccgctcaaccagggc
gcatggtactgcagccagcatcatttccgtgaagtgattccgtttggggccgctctgcgt
tatgcaggtcgcccggcctccgcctctccggcggtagggtatatgtccgttcaccagaaa
cagcaacaagatctggttaatgacgcgctgaacgtcgattaa

DBGET integrated database retrieval system