KEGG   Salmonella enterica subsp. enterica serovar Dublin: SeD_A0838Help
Entry
SeD_A0838         CDS       T00757                                 

Definition
(GenBank) cyd operon protein YbgT
  KO
K00424  cytochrome bd-I ubiquinol oxidase subunit X [EC:1.10.3.14]
Organism
sed  Salmonella enterica subsp. enterica serovar Dublin
Pathway
sed00190  Oxidative phosphorylation
sed02020  Two-component system
Module
sed_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:sed00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SeD_A0838
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SeD_A0838
Enzymes [BR:sed01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     SeD_A0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbgT_YccB
Motif
Other DBs
NCBI-ProteinID: ACH75976
Position
837200..837313
Genome map
AA seq 37 aa AA seqDB search
MWYFAWILGTLLACAFGIITALALEHVEAGKTGQEES
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatttcgcatggattctgggaacgcttcttgcctgtgcattcgggatcattacc
gccctggcgcttgagcacgttgaagcgggtaaaaccggtcaagaagaaagctaa

DBGET integrated database retrieval system